DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YAP1 and Ufd4

DIOPT Version :9

Sequence 1:XP_005271435.1 Gene:YAP1 / 10413 HGNCID:16262 Length:510 Species:Homo sapiens
Sequence 2:NP_609369.1 Gene:Ufd4 / 34378 FlyBaseID:FBgn0032208 Length:2727 Species:Drosophila melanogaster


Alignment Length:550 Identity:101/550 - (18%)
Similarity:175/550 - (31%) Gaps:154/550 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    38 PAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPK 102
            |:.|....|.|.|...||.::   |..:.....:|.:..:.:||........::|.:    .|..
  Fly  1713 PSVTLKPAQQPNAVLSIVDIK---EQPISNENVSVPSQMSISVPNLTTTSASEVPST----SEVA 1770

Human   103 SHSRQASTDAGTAGALTPQHVRAHSSP-ASLQLGAVSPGTLTPTGVVSGPAAT------------ 154
            :|:....|.|..|...|.|......:. .:.:......|....:|...|.:.|            
  Fly  1771 THTGLLETFAAIARRRTSQGTNIQDNQIMNAEANVNEHGDQNASGSFLGHSVTSLVKLALSSNFH 1835

Human   155 ----PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAP 215
                .|||.....|....:::   |....:.||:||: ..:.|:.|.|           |::|:.
  Fly  1836 SGLLSTAQSYPSLSSNNSENI---APSNPSNTSAGQQ-SASTINHTLT-----------MSLTST 1885

Human   216 TSPPVQ---QNMMNSASGP-----LPDGWEQAMTQDGE------------------------IYY 248
            :|...|   ::.:.|...|     |.|  |..|.:|.:                        :.:
  Fly  1886 SSDSEQVSLEDFLESCRAPALLGDLDD--EDDMDEDNDEEENEDEYEEVGNTLLQVMVSRNLLTF 1948

Human   249 INHK---------NKTTSWLDPRLDPRFGKAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQ 304
            ::.:         .|..||     |..|  .:.::.|...|...|.|           |.:|.||
  Fly  1949 MDDEAMENRLVGVTKRKSW-----DDEF--VLKRQFSALIPAFDPRP-----------GRTNVNQ 1995

Human   305 QQQMRLQQLQMEKERLRLKQQELLRQVRPQAMRNINPSTANSPKCQELALRSQ----LPTLEQDG 365
            ...:.:..|..|               .|:..::..|.|...| ...|.||..    :|.:|.|.
  Fly  1996 TSDLEISPLGAE---------------LPKPQQSGGPETIEQP-LLGLKLRGPGIGGIPEVEIDL 2044

Human   366 GTQNPVSSPGMSQELRTMTTNSSDPFLN------SGTYHSRDESTDSGLSMSSYSVPRTPD---- 420
            ...:......:.:.|:....|..|.|..      :..|............:.|...|:|||    
  Fly  2045 SNTDWTIFRAVQELLQCSQLNKLDKFRKIWEPTYTIVYREVSPEAQESTCLESEEFPQTPDVSSK 2109

Human   421 ---DFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTN-VDLGTLEGD----GMNIEGEELM 477
               ..|:....|..|..:..:.|.|    ..|.||.:...| ::...::.|    |:::..|:|.
  Fly  2110 SGASTLSPNSPMHIGFNVADNNLCS----VDDVLELLTQINGLNQSEIDSDVKEHGVSVLSEDLF 2170

Human   478 PSLQEALSSDILNDMES------VLAATKL 501
                  :|..|.|.::.      |||:..|
  Fly  2171 ------ISKKITNKLQQQIQDPLVLASNAL 2194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YAP1XP_005271435.1 WW 174..203 CDD:238122 8/28 (29%)
WW 232..261 CDD:366073 8/61 (13%)
Ufd4NP_609369.1 ANK repeat 393..420 CDD:293786
ANK 396..509 CDD:238125
ANK repeat 422..453 CDD:293786
ANK repeat 455..484 CDD:293786
F5_F8_type_C 1173..1298 CDD:329041
MIB_HERC2 1333..1389 CDD:310955
DamX 1576..>1725 CDD:330571 4/11 (36%)
HECTc 2265..2725 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.