DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YAP1 and CG4238

DIOPT Version :9

Sequence 1:XP_005271435.1 Gene:YAP1 / 10413 HGNCID:16262 Length:510 Species:Homo sapiens
Sequence 2:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster


Alignment Length:162 Identity:29/162 - (17%)
Similarity:55/162 - (33%) Gaps:51/162 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   102 KSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQH-LRQ--- 162
            ||...|   ||.|.|.:.              :.:||...|.....::.|:..|.|:| |.|   
  Fly   185 KSSQHQ---DAWTWGGML--------------VVSVSVAGLVTLAAMTQPSLAPEARHSLLQYVT 232

Human   163 SSFEIPDDVPLPAGWEMAKTSSGQRYFL----------------NH--------------IDQTT 197
            ..:.:|.:..:...|:...:..|...|:                :|              |.:..
  Fly   233 GKYLLPANCKVQWDWKDPASVGGTMCFVVRFFQRNGQPYPICDTDHFFVEVTEGTRKVVTISELG 297

Human   198 TWQDPRKAMLSQMNVTAPTSPPVQQNMMNSAS 229
            :..||..|.::::..|..|:...:.:::..||
  Fly   298 SSTDPNNANIAKVKFTVRTAGQYKISVLIGAS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YAP1XP_005271435.1 WW 174..203 CDD:238122 6/58 (10%)
WW 232..261 CDD:366073
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720 13/92 (14%)
Filamin 238..336 CDD:279024 13/92 (14%)
HECTc 615..975 CDD:238033
HECTc 642..974 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.