Sequence 1: | XP_005271435.1 | Gene: | YAP1 / 10413 | HGNCID: | 16262 | Length: | 510 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_594902.1 | Gene: | ptr1 / 2542537 | PomBaseID: | SPAC19D5.04 | Length: | 3227 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 254 | Identity: | 49/254 - (19%) |
---|---|---|---|
Similarity: | 93/254 - (36%) | Gaps: | 60/254 - (23%) |
- Green bases have known domain annotations that are detailed below.
Human 302 SNQQQQMRLQQLQME---------------KERLRLKQQELLRQVRPQAMRNINPSTANSPKCQE 351
Human 352 LALRSQ------------LPTLEQDGGTQNPVSSPGMS------------QELRTMT-----TNS 387
Human 388 SDPFLNSGTYHSRDESTDSGLSMSSYSV-----PRTPDDFLNSVDEMDTGDTINQSTLPSQQNRF 447
Human 448 PDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESF 506 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
YAP1 | XP_005271435.1 | WW | 174..203 | CDD:238122 | |
WW | 232..261 | CDD:366073 | |||
ptr1 | NP_594902.1 | DUF908 | 96..367 | CDD:283630 | |
DUF913 | 436..735 | CDD:283642 | |||
HARE-HTH | <1930..2018 | CDD:294801 | |||
DUF4414 | 2267..2347 | CDD:291075 | |||
HUL4 | 2314..3227 | CDD:227354 | |||
HECTc | 2870..3225 | CDD:238033 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5021 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |