DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YAP1 and ptr1

DIOPT Version :9

Sequence 1:XP_005271435.1 Gene:YAP1 / 10413 HGNCID:16262 Length:510 Species:Homo sapiens
Sequence 2:NP_594902.1 Gene:ptr1 / 2542537 PomBaseID:SPAC19D5.04 Length:3227 Species:Schizosaccharomyces pombe


Alignment Length:254 Identity:49/254 - (19%)
Similarity:93/254 - (36%) Gaps:60/254 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   302 SNQQQQMRLQQLQME---------------KERLRLKQQELLRQVRPQAMRNINPSTANSPKCQE 351
            ||:||...:.:::.|               .|.|.....:|| .:.....|..:..|.:......
pombe  1677 SNEQQTQAVDEIRREVLTSVLKFYKSSSSFSENLEAYYCKLL-VLAELCYRLCDAQTVSQKAPNH 1740

Human   352 LALRSQ------------LPTLEQDGGTQNPVSSPGMS------------QELRTMT-----TNS 387
            |..|||            :|||      .|.:|...|:            :.|:.:|     .:.
pombe  1741 LLRRSQDQNVKTMIDLGYIPTL------TNAISEIDMNYPVSRKVVRHILKPLQLLTKEAIFLSQ 1799

Human   388 SDPFLNSGTYHSRDESTDSGLSMSSYSV-----PRTPDDFLNSVDEMDTGDTINQSTLPSQQNRF 447
            ::|...||.  ::|...|..||.||...     ...||.:.|||..:..||.:|::....:.:..
pombe  1800 TNPEALSGA--AQDSMGDQSLSSSSEESSDSDREEPPDLYRNSVLGIFQGDIVNENDENYEDSED 1862

Human   448 PDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESF 506
            ....|.:...:...|:.:......:.:::|.|..:.::.:.:.|.:.  |:::.|..||
pombe  1863 DGVYEEMEFEDDQSGSADSVVSEDDADDVMYSDNDDMNIEFMVDEQD--ASSQNDDSSF 1919

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YAP1XP_005271435.1 WW 174..203 CDD:238122
WW 232..261 CDD:366073
ptr1NP_594902.1 DUF908 96..367 CDD:283630
DUF913 436..735 CDD:283642
HARE-HTH <1930..2018 CDD:294801
DUF4414 2267..2347 CDD:291075
HUL4 2314..3227 CDD:227354
HECTc 2870..3225 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.