DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYL9 and Mlc2

DIOPT Version :9

Sequence 1:NP_006088.2 Gene:MYL9 / 10398 HGNCID:15754 Length:172 Species:Homo sapiens
Sequence 2:NP_524586.1 Gene:Mlc2 / 43587 FlyBaseID:FBgn0002773 Length:222 Species:Drosophila melanogaster


Alignment Length:174 Identity:67/174 - (38%)
Similarity:101/174 - (58%) Gaps:6/174 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     3 SKRAKAKTT-KKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPT 66
            ||||...:. .::.:||.|:||::|.|.||.||||||.::|.::||.|.|.||.....|:||...
  Fly    48 SKRASGGSRGSRKSKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKIAN 112

Human    67 DEYLEGMMSEAPGPINFTMFLTMFGEKL---NGTDPEDVIRNAFACFDEEASGFIHEDHLRELLT 128
            |:.|:.|:.||.||||||..||:|..::   ...|.::|:..||..||.:  |.|..|..||:|.
  Fly   113 DKELDAMLGEASGPINFTQLLTLFANRMATSGANDEDEVVIAAFKTFDND--GLIDGDKFREMLM 175

Human   129 TMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD 172
            ..||:||.:|||:.|.:..||.|...:......:|....:::::
  Fly   176 NFGDKFTMKEVDDAYDQMVIDDKNQIDTAALIEMLTGKGEEEEE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYL9NP_006088.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 6/17 (35%)
FRQ1 19..169 CDD:227455 61/152 (40%)
Mlc2NP_524586.1 PTZ00184 73..213 CDD:185504 57/141 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.