DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYL9 and CG34402

DIOPT Version :9

Sequence 1:NP_006088.2 Gene:MYL9 / 10398 HGNCID:15754 Length:172 Species:Homo sapiens
Sequence 2:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster


Alignment Length:175 Identity:34/175 - (19%)
Similarity:53/175 - (30%) Gaps:62/175 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    43 QNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAP-------------GPINFTM--------- 85
            :|..|....:.||.:....|:..|.|.|.|.....|             |....||         
  Fly   442 ENSTGCQPGDALHVVTELRGRYETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGF 506

Human    86 -----FLTMFGEKLNGTDPE--DVIRNAFACFDEEASGFIHEDHL-------------------- 123
                 |||.|| .::|...|  ..:.|:    .|..||..|..:.                    
  Fly   507 RAEYRFLTNFG-IMSGIQKEGCSFVYNS----SERISGLFHSPNFPGYYLENVVCNYYFYGASDE 566

Human   124 RELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAK 168
            |.:|     .||..:::.:   ...|.:...:|:||:..:....|
  Fly   567 RVVL-----HFTYFDIEGI---GSCDHQTASDYIEFSNFMSTDRK 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYL9NP_006088.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
FRQ1 19..169 CDD:227455 34/175 (19%)
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 13/69 (19%)
CUB 527..644 CDD:238001 14/89 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.