DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYL9 and Sol1

DIOPT Version :10

Sequence 1:NP_006088.2 Gene:MYL9 / 10398 HGNCID:15754 Length:172 Species:Homo sapiens
Sequence 2:NP_001097756.1 Gene:Sol1 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster


Alignment Length:175 Identity:34/175 - (19%)
Similarity:53/175 - (30%) Gaps:62/175 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    43 QNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAP-------------GPINFTM--------- 85
            :|..|....:.||.:....|:..|.|.|.|.....|             |....||         
  Fly   442 ENSTGCQPGDALHVVTELRGRYETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGF 506

Human    86 -----FLTMFGEKLNGTDPE--DVIRNAFACFDEEASGFIHEDHL-------------------- 123
                 |||.|| .::|...|  ..:.|:    .|..||..|..:.                    
  Fly   507 RAEYRFLTNFG-IMSGIQKEGCSFVYNS----SERISGLFHSPNFPGYYLENVVCNYYFYGASDE 566

Human   124 RELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAK 168
            |.:|     .||..:::.:   ...|.:...:|:||:..:....|
  Fly   567 RVVL-----HFTYFDIEGI---GSCDHQTASDYIEFSNFMSTDRK 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYL9NP_006088.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PTZ00184 25..163 CDD:185504 33/168 (20%)
Sol1NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 13/69 (19%)
CUB 527..644 CDD:238001 14/89 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.