DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYL9 and CG33098

DIOPT Version :9

Sequence 1:NP_006088.2 Gene:MYL9 / 10398 HGNCID:15754 Length:172 Species:Homo sapiens
Sequence 2:NP_001262501.1 Gene:CG33098 / 326253 FlyBaseID:FBgn0053098 Length:230 Species:Drosophila melanogaster


Alignment Length:169 Identity:55/169 - (32%)
Similarity:84/169 - (49%) Gaps:7/169 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    11 TKKRPQRATSNVFA-MFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMM 74
            |.....||..||.. ..|.:::.|.||.|::.|.:.||.|.|:||.....:||..|.::.||.||
  Fly    62 TLPEEMRADDNVAPHELDIAKLAELKEVFSLFDTDCDGLISKDDLRFTYTALGNEPNEQLLEQMM 126

Human    75 SEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEV 139
            .||..|:::..|:.:...:....|||||:..|::.:|:..:|.|.|..:.|.||..||:.|..|.
  Fly   127 QEAKEPLDYEAFVRLMSRRTQELDPEDVLLEAWSKWDDHGTGKIDERKIYEELTNYGDKMTLNEA 191

Human   140 DEMYREAPIDKKGN------FNYVEFTRILKHGAKDKDD 172
            .|....||:.|..:      .:|..|.|:|....|.|.:
  Fly   192 KEALSHAPMAKPKSLEEPPMIDYPAFCRMLSGMRKRKGE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYL9NP_006088.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 3/8 (38%)
FRQ1 19..169 CDD:227455 50/156 (32%)
CG33098NP_001262501.1 FRQ1 76..195 CDD:227455 41/118 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.