DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYL9 and CG31802

DIOPT Version :9

Sequence 1:NP_006088.2 Gene:MYL9 / 10398 HGNCID:15754 Length:172 Species:Homo sapiens
Sequence 2:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster


Alignment Length:168 Identity:53/168 - (31%)
Similarity:84/168 - (50%) Gaps:15/168 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     3 SKRAKAKTTKKRPQRATSNVFAMFDQSQIQ--EFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNP 65
            |.|||   ..|:|:..|      ||.|..|  :.|:||::.|....|||:.::|...:.:||..|
  Fly    23 SSRAK---KSKKPKLPT------FDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEP 78

Human    66 TDEYLEGMMSE----APGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLREL 126
            ..|.::.||.|    ..|.|.|..||.:...|:...|....:..||:.||::.:|.|...:|:.:
  Fly    79 KKEDIKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRV 143

Human   127 LTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILK 164
            ...:|::.||||:.||..||.:...|..:..||..::|
  Fly   144 AKELGEQLTDEELQEMIDEANVSGDGEVSKEEFLNLIK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYL9NP_006088.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 6/16 (38%)
FRQ1 19..169 CDD:227455 47/152 (31%)
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 45/144 (31%)
EFh 46..108 CDD:238008 20/61 (33%)
EFh 119..181 CDD:238008 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.