DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYL9 and CG30378

DIOPT Version :9

Sequence 1:NP_006088.2 Gene:MYL9 / 10398 HGNCID:15754 Length:172 Species:Homo sapiens
Sequence 2:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster


Alignment Length:143 Identity:37/143 - (25%)
Similarity:84/143 - (58%) Gaps:8/143 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    28 QSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEA----PGPINFTMFLT 88
            ::||:|.:|||::.|:.|.|::..:.|..::.:||::.|:..:..:.:|:    .|.:.|..||.
  Fly     7 EAQIEEIREAFSLYDKERSGWVSVQQLGGVMRALGESLTEAEIYDLANESNADFGGQVQFKDFLY 71

Human    89 MFGEKLNGTDPEDVIRNAFACFD-EEASGF-IHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKK 151
            :..::|...:....::.||..|| .|.:.| |:|  :|.::|.:|::.::|::.|::::...||.
  Fly    72 VMSKRLEEQNSLVCLKQAFKIFDRSEVNSFTINE--IRMVMTNLGEKMSEEDLRELFQDIDQDKD 134

Human   152 GNFNYVEFTRILK 164
            |..::.||...::
  Fly   135 GKISFNEFVTAMR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYL9NP_006088.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
FRQ1 19..169 CDD:227455 37/143 (26%)
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 37/143 (26%)
EFh 12..74 CDD:238008 16/61 (26%)
EFh 86..147 CDD:238008 18/62 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.