DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCML2 and lin-61

DIOPT Version :9

Sequence 1:NP_006080.1 Gene:SCML2 / 10389 HGNCID:10581 Length:700 Species:Homo sapiens
Sequence 2:NP_001122501.1 Gene:lin-61 / 172467 WormBaseID:WBGene00003041 Length:612 Species:Caenorhabditis elegans


Alignment Length:250 Identity:78/250 - (31%)
Similarity:112/250 - (44%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     5 VNEDSMDVKKENQEKT-------PQSSTSSVQRDDFHWEEYLKETGSISAPSECFRQSQIPPV-- 60
            ||...::.|||..|.|       ..........||..:::..|:              .|.|:  
 Worm   375 VNGYQLNAKKEYIEHTNKIAQAIKNGENPRYDSDDVTFDQLAKD--------------PIDPMIW 425

Human    61 NDFKVGMKLEARDP--RNATSVCIATVIGI--TGARLRLRLDGSDNRNDFWRL-VDSPDIQPVGT 120
            ...|||.|.|..||  :...::.:|:::..  |...|.:.:||.|...|.:.: :::..:.|||.
 Worm   426 RKVKVGQKFELIDPLAQQFNNLHVASILKFCKTEGYLIVGMDGPDALEDSFPIHINNTFMFPVGY 490

Human   121 CEKEGDLLQPPLGYQMNTSSWPMFLLKTLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKN 185
            .||....|.||..:: .|..|..:|.|  ..:|.....|||..|.:..|:.||||::|||.|...
 Worm   491 AEKYNLELVPPDEFK-GTFRWDEYLEK--ESAETLPLDLFKPMPSQERLDKFKVGLRLEAADMCE 552

Human   186 PYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPP 240
            ...|||||:..|.|..:::.||||...||.....||.||.|.|||.....|||||
 Worm   553 NQFICPATVKSVHGRLINVNFDGWDEEFDELYDVDSHDILPIGWCEAHSYVLQPP 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCML2NP_006080.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 8/34 (24%)
MBT 1 33..131 23/104 (22%)
MBT 36..131 CDD:214723 23/101 (23%)
MBT 2 139..240 41/100 (41%)
MBT 142..240 CDD:214723 40/97 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..320
DUF3588 356..465 CDD:288954
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 466..550
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 575..594
SAM_Scm 625..696 CDD:188977
SAM 628..696 CDD:197735
lin-61NP_001122501.1 MBT 146..248 CDD:214723
MBT 283..383 CDD:214723 2/7 (29%)
MBT 433..505 CDD:280910 19/71 (27%)
MBT 511..607 CDD:214723 40/97 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161457478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.