DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMG20B and Sox100B

DIOPT Version :10

Sequence 1:NP_006330.2 Gene:HMG20B / 10362 HGNCID:5002 Length:317 Species:Homo sapiens
Sequence 2:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster


Alignment Length:138 Identity:34/138 - (24%)
Similarity:58/138 - (42%) Gaps:26/138 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   121 WQQEKKGLQLVCGEMAYQVVKKSAALDTLQSQLEERQ-----DRLEALQACVVQLQEARAQQSRQ 180
            :.|||||    |  :..|:|  ...|..|..||:::.     |.::|..:..::.:|.....:|.
  Fly    22 FDQEKKG----C--IGTQMV--GTILSMLGHQLDDKMLKEIIDEVDADGSGELEFEEFVTLAARF 78

Human   181 LEERQAENAAQREAYETLLQQAVHQEAALRRLQEEARDLLEQLVQRKARAAAERNLRNERRERIP 245
            :.|..|| |.|:|..|           |.|...:|....:...|.|:.....:.||.||..:.:.
  Fly    79 MVEEDAE-AMQQELKE-----------AFRLYDKEGNGYITTQVLREILKELDDNLTNEDLDMMI 131

Human   246 NTLE-DGT 252
            ..:: ||:
  Fly   132 EEIDSDGS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HMG20BNP_006330.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71
HMG-box_HMG20B 69..147 CDD:438834 8/25 (32%)
Sox100BNP_651839.1 HMG-box_SoxE 76..150 CDD:438840 19/76 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.