DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMG20B and jigr1

DIOPT Version :9

Sequence 1:NP_006330.2 Gene:HMG20B / 10362 HGNCID:5002 Length:317 Species:Homo sapiens
Sequence 2:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster


Alignment Length:187 Identity:36/187 - (19%)
Similarity:69/187 - (36%) Gaps:56/187 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    57 PKGKKRKKILPNGPKAPV--TG----------------YVRFLNERREQIRTRHPDLPFPEITKM 103
            |||:.|       |:|..  ||                |.|.....::::...|   .:.:|...
  Fly    13 PKGRGR-------PRATYAQTGEFDLGLIREYRSHPVLYDRSNKRFKDKLYVAH---IWEQIAHK 67

Human   104 LGAEWSKLQ---PTEKQRYLDEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKK------IKKED 159
            ||.:.:.::   .|.:.||..|..|.:.....:...:...|:.:...:.|:.::      :|:||
  Fly    68 LGYDATSIRERMTTLRNRYNIEKRRVENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMSVKEED 132

Human   160 -----------SSSGLMNTLLNGHKGGDCDGFSTFD----VPIFTEEFLDQNKAREA 201
                       .|:|.||::.:..:    |....||    :|:.|...:..|.:.||
  Fly   133 EETYEVDDCRSDSNGHMNSIKDELE----DDSEIFDCEQALPVTTVLGIPLNNSDEA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HMG20BNP_006330.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 4/13 (31%)
HMGB-UBF_HMG-box 70..135 CDD:238686 15/85 (18%)
jigr1NP_001097920.1 MADF 33..118 CDD:214738 12/87 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.