DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMG20B and tHMG2

DIOPT Version :9

Sequence 1:NP_006330.2 Gene:HMG20B / 10362 HGNCID:5002 Length:317 Species:Homo sapiens
Sequence 2:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster


Alignment Length:105 Identity:24/105 - (22%)
Similarity:46/105 - (43%) Gaps:10/105 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    70 PKAPVTGYVRFLNER-REQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKE 133
            ||.|::.::.::|.. |:.||..|||....|::...|..|..:....|..:.:.|.:...:|.::
  Fly     9 PKKPMSAFMLWMNSTGRKNIRAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEYKEK 73

Human   134 LRAY-----QQSEAYKMCTEKIQEKKIKKEDSSSGLMNTL 168
            |..:     .|:|::    ..|.|..:....|.:....||
  Fly    74 LEKWNAFKEHQTESF----PHIYEAPLSSRFSKTNQRPTL 109

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity