DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMG20B and Dsp1

DIOPT Version :9

Sequence 1:NP_006330.2 Gene:HMG20B / 10362 HGNCID:5002 Length:317 Species:Homo sapiens
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:152 Identity:45/152 - (29%)
Similarity:73/152 - (48%) Gaps:15/152 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    42 EKGSHEEE-----PVKKRGWPKGKKRKKIL-PNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEI 100
            :|..:|.|     |.|.....:|||||:|. ||.||..::.:..|.|:.|.:::..:|:....:|
  Fly   241 DKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDI 305

Human   101 TKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLM 165
            .|.||.:||.:.|..||:|...|||:|.:|.:|:..|:.|....|....:| ..::.:...:.|:
  Fly   306 AKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQ-ASMQAQAQKAALL 369

Human   166 --------NTLLNGHKGGDCDG 179
                    ..|...|...|.||
  Fly   370 AAAAQQQHQQLEEQHDDDDGDG 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HMG20BNP_006330.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 13/34 (38%)
HMGB-UBF_HMG-box 70..135 CDD:238686 22/64 (34%)
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 3/10 (30%)
HMGB-UBF_HMG-box 275..339 CDD:238686 21/63 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.