DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TLR6 and Tl

DIOPT Version :9

Sequence 1:NP_001381482.1 Gene:TLR6 / 10333 HGNCID:16711 Length:796 Species:Homo sapiens
Sequence 2:NP_001262995.1 Gene:Tl / 43222 FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster


Alignment Length:913 Identity:214/913 - (23%)
Similarity:352/913 - (38%) Gaps:253/913 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    41 RGLIHVPKD----------LPLKTKVLDMSQNYIAELQVSDMSFLSELTVLRLSHNRIQLLDLSV 95
            |.|.|:|.:          |.|:..:.:|..:...:|:        .|..:....|:::.:...:
  Fly   160 RRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLE--------NLESIEFGSNKLRQMPRGI 216

Human    96 FKFNQDLEYLDLSHNQLQKISCH---------------------PIVSFRHL------DLSFNDF 133
            |.....|:.|:|..|||..::.|                     |...|.||      :||.|.|
  Fly   217 FGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLF 281

Human   134 KALP-------------------------ICKEFGNLSQLNFLGLSAMKLQKL--DLL----PIA 167
            ::||                         ..:.|.|..:|..|.|.| :||.|  ||.    .|.
  Fly   282 RSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLRA-ELQSLPGDLFEHSTQIT 345

Human   168 HLHLSYILLDLRNYYIKENETE--SLQILNAKTLHLVFHPTSLFAIQVNI--------------- 215
            ::.|...||......:.|::..  ||.:.|.:..||   |.||||...|:               
  Fly   346 NISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHL---PDSLFAHTTNLTDLRLEDNLLTGISG 407

Human   216 ----SVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPK 276
                ::..|..|.::..:|...:.:.|:.     |.|...|:...|.|:.....|..:.|.....
  Fly   408 DIFSNLGNLVTLVMSRNRLRTIDSRAFVS-----TNGLRHLHLDHNDIDLQQPLLDIMLQTQINS 467

Human   277 PVEY------LNIYNLTII----------ESIREEDFTYSKTTLKALTIEHITNQVFLFSQTALY 325
            |..|      ||:.|.:||          ..:||.|.:|:  .:.:|..|.:   .|| ||..|:
  Fly   468 PFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYN--NISSLGYEDL---AFL-SQNRLH 526

Human   326 TVFS-------------------EMNIMMLTISDTPFIHMLCPHAPSTFKFLNFTQNVFTDSIFE 371
            ...:                   ..|::.:.::|.|   ::|.  .:...|:...:.|..    .
  Fly   527 VNMTHNKIRRIALPEDVHLGEGYNNNLVHVDLNDNP---LVCD--CTILWFIQLVRGVHK----P 582

Human   372 KCSTLVKLET---LILQKNGLKDLFKVGLMTKDM-PSLEI--LDVSWNSLESGRHKE-----NC- 424
            :.|...||.|   :..|.|.|:     |...:.: |...|  ||.|    :..|.::     || 
  Fly   583 QYSRQFKLRTDRLVCSQPNVLE-----GTPVRQIEPQTLICPLDFS----DDPRERKCPRGCNCH 638

Human   425 --TWVESIVVLNLSSNMLTDSVFRCLPPRI-------KVLDLH--SNKIKSVPK-QVVKLEALQE 477
              |: :..:|:|..|..||.      .||:       ::::||  :|.:..:|. .....|::..
  Fly   639 VRTY-DKALVINCHSGNLTH------VPRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTS 696

Human   478 LNVAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSA---DFFQSCQKMRSIKAGDNPFQCTCELRE 539
            |::|.|:||.:......::|:.|.|..|.:...:|   .|.....|.||:|...||:.|.|..:.
  Fly   697 LHLAGNNLTSIDVDQLPTNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKP 761

Human   540 FV----KNIDQVSSEVLEGWPDSYKCDYPESYRGSPLKDFHMSELSCN---------ITLLIVTI 591
            .:    .|.:::      |..:...|...|    .|.:   |.|||.|         ...|.|.|
  Fly   762 LLLFTQDNFERI------GDRNEMMCVNAE----MPTR---MVELSTNDICPAEKGVFIALAVVI 813

Human   592 GATMLVLAVTV-------TSLCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYS 649
            ..|.|:...|.       |.:.|:|    |...:..|..|.        |:|.::.:|.||||||
  Fly   814 ALTGLLAGFTAALYYKFQTEIKIWL----YAHNLLLWFVTE--------EDLDKDKKFDAFISYS 866

Human   650 EHDSAWVKSELVPYLE--KEDIQICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWC 712
            ..|.::::..|||.||  .:..|:|:|||:::.|..|.|||:..:..|.::|.|||.||::|||.
  Fly   867 HKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWA 931

Human   713 HYELYFAHHNLFHEGSNNLILILLEPIPQNSIPNKYHKLKALMTQRTYLQWPKEKSKRGLFWANI 777
            ..|...||.:..:||.:.:|:|:...|  ..:.....:|||.:...|||:|...     .||..:
  Fly   932 RLEFRAAHRSALNEGRSRIIVIIYSDI--GDVEKLDEELKAYLKMNTYLKWGDP-----WFWDKL 989

Human   778 RAA 780
            |.|
  Fly   990 RFA 992

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TLR6NP_001381482.1 LRR 1 54..77 2/22 (9%)
LRR 2 78..101 3/22 (14%)
LRR 3 102..122 8/40 (20%)
LRR 4 123..147 11/54 (20%)
LRR 5 148..168 10/25 (40%)
LRR 6 169..196 6/28 (21%)
LRR 7 197..219 8/40 (20%)
LRR 8 220..250 6/29 (21%)
LRR 9 251..277 5/25 (20%)
LRR 10 278..303 10/40 (25%)
LRR 11 304..330 7/44 (16%)
LRR 12 331..354 4/22 (18%)
LRR 13 355..378 3/22 (14%)
LRR 14 379..404 6/28 (21%)
LRR 15 405..429 8/33 (24%)
LRR 16 430..450 5/19 (26%)
LRR 17 451..474 5/32 (16%)
LRR 18 475..496 5/20 (25%)
LRR 19 497..520 6/25 (24%)
TlNP_001262995.1 LRR_8 174..233 CDD:290566 11/66 (17%)
leucine-rich repeat 176..198 CDD:275380 4/29 (14%)
leucine-rich repeat 199..222 CDD:275380 3/22 (14%)
LRR_RI 216..542 CDD:238064 74/340 (22%)
LRR_8 221..281 CDD:290566 14/59 (24%)
leucine-rich repeat 223..270 CDD:275380 11/46 (24%)
leucine-rich repeat 271..294 CDD:275380 6/22 (27%)
leucine-rich repeat 295..320 CDD:275380 2/24 (8%)
leucine-rich repeat 321..343 CDD:275380 9/22 (41%)
LRR_8 342..402 CDD:290566 16/62 (26%)
leucine-rich repeat 344..367 CDD:275380 5/22 (23%)
leucine-rich repeat 368..391 CDD:275380 10/25 (40%)
LRR_8 390..450 CDD:290566 9/64 (14%)
leucine-rich repeat 392..415 CDD:275380 0/22 (0%)
leucine-rich repeat 416..439 CDD:275380 5/27 (19%)
leucine-rich repeat 440..474 CDD:275380 7/33 (21%)
leucine-rich repeat 475..498 CDD:275380 5/22 (23%)
LRR_8 477..534 CDD:290566 16/62 (26%)
leucine-rich repeat 499..520 CDD:275380 6/25 (24%)
leucine-rich repeat 523..552 CDD:275380 1/28 (4%)
LRRCT 561..619 CDD:214507 14/71 (20%)
LRRNT 631..667 CDD:214470 10/42 (24%)
leucine-rich repeat 664..693 CDD:275380 4/28 (14%)
LRR_8 669..726 CDD:290566 14/56 (25%)
leucine-rich repeat 694..715 CDD:275380 5/20 (25%)
leucine-rich repeat 716..737 CDD:275380 5/20 (25%)
LRRCT 751..800 CDD:214507 14/61 (23%)
TIR 858..996 CDD:214587 52/142 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147327at33208
OrthoFinder 1 1.000 - - FOG0000239
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24365
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X221
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.