DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNPY2 and sel

DIOPT Version :9

Sequence 1:NP_055070.1 Gene:CNPY2 / 10330 HGNCID:13529 Length:182 Species:Homo sapiens
Sequence 2:NP_610547.1 Gene:sel / 36046 FlyBaseID:FBgn0263260 Length:189 Species:Drosophila melanogaster


Alignment Length:174 Identity:52/174 - (29%)
Similarity:98/174 - (56%) Gaps:10/174 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     8 ALLLGALLGTA--WARRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVP 70
            ||:|..||..|  ::..|:::.|..|:|:|.|||..||:.||.|...:..||::..|:....:|.
  Fly     5 ALILFGLLALAQGYSFTSREVKCHVCKAVVTELEEAIAKEDPHKMADVSGFRLDAQGNSISKKVR 69

Human    71 YARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVV--GR-NGESSELDLQGIRIDSDISGT 132
            ..:||..||||:|:||::|.:|.:....|..:...::::  |: |.:||.:|...   |.|::.:
  Fly    70 LVKSEMFLTELMEKICEKMDDYLKATYKSNGKFTLLKMIINGQMNPDSSLVDFVQ---DGDLNKS 131

Human   133 LKFACESIVEEYEDELIEFFSRE--ADNVKDKLCSKRTDLCDHA 174
            |...|..::|:.::..::.|..|  .:::..|:||::...||.:
  Fly   132 LGHFCNEVLEDNDEIFVKAFQAEELGNDLDIKICSEQASYCDES 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNPY2NP_055070.1 DUF3456 27..165 CDD:403222 41/142 (29%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 179..182
selNP_610547.1 DUF3456 26..166 CDD:288766 41/142 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I9010
eggNOG 1 0.900 - - E1_KOG3782
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5184
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48415
OrthoDB 1 1.010 - - D1417418at2759
OrthoFinder 1 1.000 - - FOG0003185
OrthoInspector 1 1.000 - - oto90486
orthoMCL 1 0.900 - - OOG6_105647
Panther 1 1.100 - - LDO PTHR13341
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4170
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.