DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMYD5 and Smyd4-3

DIOPT Version :9

Sequence 1:NP_006053.2 Gene:SMYD5 / 10322 HGNCID:16258 Length:418 Species:Homo sapiens
Sequence 2:NP_725048.1 Gene:Smyd4-3 / 36234 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster


Alignment Length:402 Identity:95/402 - (23%)
Similarity:152/402 - (37%) Gaps:133/402 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    21 VSVEVRFVS------SAKGKGLF--ATQLIRKGETIFVERPLVAAQFLWNALYRYRACDHCLRAL 77
            |.:|..|||      |.:.:|.|  |:..::.||.:.||||.|:.                  .|
  Fly   230 VKLENEFVSPLVRIDSNRQEGRFARASADVKPGEELLVERPFVSV------------------LL 276

Human    78 EKAEENAQRLTGKPGQVLPHPELCTVRKDLHQNCPHC-QVMYCSAECRLAATEQYHQVLCPGPSQ 141
            ||..:.             |.|.|.:|..:...||.| .|:|||.:||..|:::||:..|     
  Fly   277 EKFAKT-------------HCENCFMRTVVPVACPRCADVLYCSEQCREEASKKYHKYEC----- 323

Human   142 DDPLHPLNKLQEAWRSIHYPPETASI--MLMARMVATVKQAKDKDRWIRLFSQFCNKTANEE--- 201
              .:.|:     .|||      .|||  .:..|::|    :|..|.:::|     ..|.:||   
  Fly   324 --GIVPI-----IWRS------GASINNHIALRIIA----SKPLDYFLKL-----KPTIDEELTP 366

Human   202 EEIVHKLLGDKFK--GQLE---------------LLRRLFTEALYEEAVSQWF----TPDGFRSL 245
            |::: .|..|.|:  .|||               |:.|..|..|   ....:|    .||....:
  Fly   367 EQLI-SLPKDDFRRVAQLERHQGERQPSNFFQHVLMARFLTNCL---RAGGYFGSEPKPDEVSII 427

Human   246 FALVGTNGQGIGTSSLSQWVHACDTLELKPQDREQLDAFIDQLYKDIEAATGE----FLNCEGSG 306
            .:||               :.:...::....:..:|..|         :::|.    |:   |..
  Fly   428 CSLV---------------LRSLQFIQFNTHEVAELHKF---------SSSGREKSIFI---GGA 465

Human   307 LFVLQSCCNHSCVPNAETSFPENNFLLHVTALEDIKPGEEICISYLDC-CQRERSRHSRHKILRE 370
            ::...:..||||.|.....|  ....:|:.::..|:.|..|..:|... .|.|||  .|...|::
  Fly   466 IYPTLALFNHSCDPGVVRYF--RGTTIHINSVRPIEAGLPINENYGPMYTQDERS--ERQARLKD 526

Human   371 NYLFVCSCPKCL 382
            .|.|.|||..|:
  Fly   527 LYWFECSCDACI 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMYD5NP_006053.2 SET <298..351 CDD:214614 12/56 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..418
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 15/38 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.