DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMYD5 and Smyd4-1

DIOPT Version :9

Sequence 1:NP_006053.2 Gene:SMYD5 / 10322 HGNCID:16258 Length:418 Species:Homo sapiens
Sequence 2:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster


Alignment Length:408 Identity:98/408 - (24%)
Similarity:148/408 - (36%) Gaps:119/408 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    32 KGKGLFATQLIRKGETIFVERPLVAAQFLWNALYRYRACDHCLRALEKAEENAQRLTGKPGQVLP 96
            :|:.:.|.:.|.||..||.||   |:.|:  .|.:...|..|...|..|               |
  Fly   225 RGRYMVAKEAISKGNVIFSER---ASCFV--PLEQLLICQQCAATLMSA---------------P 269

Human    97 HPELCTVRKDLHQNCPHC--QVMYCSAECRLAATEQYHQVLCPGPSQDDPLHPLNKLQEAWRSI- 158
            .|            ||:|  :|:|||.:|| .|....|:..| ...:.|.|..|.....|.|.: 
  Fly   270 IP------------CPNCHQRVVYCSRKCR-EAHSAIHKFEC-AAYRKDILRLLGISHLALRLLL 320

Human   159 --------HYPPETAS------IMLMARMVATVKQAKDKDRWIRLFSQFCNKTANEEEEIVHKLL 209
                    |....|::      ||.::|.....:.|.:..|.:|:.||.  ..|.:||...|.|.
  Fly   321 TYIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQL--DQAIDEELNYHILC 383

Human   210 GDKFKGQLELLRRLFTEALYEEAVSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWV--------- 265
            .:       ||:      ||.:..:.::  |.|.||            .:|:..|.         
  Fly   384 AN-------LLQ------LYLKEHTDFY--DQFHSL------------PASIEDWQLIISALILR 421

Human   266 ---------HACDTL---ELKPQDREQLDAFIDQLYKDIEAATGEFLNCEGSGLFV-----LQSC 313
                     |..|.|   .::|::...|...:.|  |......|:..|...|....     ..|.
  Fly   422 FAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQ--KPRHLKRGQLHNLSHSDPITAINLPYLSL 484

Human   314 CNHSCVPNAETSFPENNFLLHVTALEDIKPGEEI--C--ISYLDCCQRERSRHSRHKILRENYLF 374
            |||:|.|:..|.|...:.:.:  |.:||..||||  |  :.|.:..:.:||..     |:..|.|
  Fly   485 CNHACEPSIRTKFDGCSVVNY--AAKDILEGEEIFNCYTMDYRNSLKLQRSHP-----LKAIYKF 542

Human   375 VCSCPKCLAEADEPNVTS 392
            .|:|.||.....:.|..|
  Fly   543 ECTCAKCTRTDPDQNYLS 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMYD5NP_006053.2 SET <298..351 CDD:214614 18/61 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..418 2/8 (25%)
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 17/67 (25%)
SET <447..526 CDD:214614 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.