DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gstt3 and GstE9

DIOPT Version :9

Sequence 1:NP_598755.1 Gene:Gstt3 / 103140 MGIID:2143526 Length:241 Species:Mus musculus
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:206 Identity:63/206 - (30%)
Similarity:95/206 - (46%) Gaps:16/206 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MG-LELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDGDFVL 64
            || |.||....|.|.||..:.....|:.::.|.:.||.|:..|..|:..||...||.|:|....:
  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFI 65

Mouse    65 AESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMFPVFLGQ--P 127
            .||.||..||.|:|...|..||:|...||.||:.|.::...|...|.|    .:..|:|...  .
  Fly    66 WESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIR----NIAIPLFYKNITE 126

Mouse   128 VPPEMLASTLAELDGCLQVLE--DKFLRNQAFLTGSHISVADLVAITELMHPVSAGCKIFESRPK 190
            ||       .:::|...:..:  :.|:.|||:|.|..|::||...::.:...|.......:..||
  Fly   127 VP-------RSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPK 184

Mouse   191 LAAWRQRVEAE 201
            |..|..|:.|:
  Fly   185 LNGWLDRMAAQ 195

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Gstt3NP_598755.1 GstA 3..217 CDD:223698 61/203 (30%)
GST_N_Theta 3..78 CDD:239348 27/74 (36%)