DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAK4 and hpo

DIOPT Version :9

Sequence 1:NP_001014831.1 Gene:PAK4 / 10298 HGNCID:16059 Length:591 Species:Homo sapiens
Sequence 2:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster


Alignment Length:277 Identity:101/277 - (36%)
Similarity:156/277 - (56%) Gaps:12/277 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   317 PRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVK----KMDLRKQQRRELLFNEVVIMRDYQHEN 377
            |....|...|:||||.|.|..|..:.|..:||:|    :.||.:      :..|:.||:......
  Fly    38 PEKVFDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHE------IIKEISIMQQCDSPY 96

Human   378 VVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTR--MNEEQIAAVCLAVLQALSVLHAQGVIHRD 440
            ||..|.||....:||:.||:...|:::||:...:  :.|::||.:....||.|..||.:..||||
  Fly    97 VVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRD 161

Human   441 IKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMV 505
            ||:.:|||..:|..||:|||...|::..:.:|.:::|||:|||||:|..:.|....|||||||..
  Fly   162 IKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITA 226

Human   506 IEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHP 570
            :||.:|:|||....|::|:.||....||..:...:.|.....|:.:.||::|..||||.|||:|.
  Fly   227 LEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHE 291

Human   571 FLAKAGPPASIVPLMRQ 587
            |:..|...:.:.|::.:
  Fly   292 FIRNAKHRSILKPMLEE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAK4NP_001014831.1 CRIB_PAK_like 10..55 CDD:238526
Linker 25..320 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..301
GEF-interaction domain (GID) 298..323 1/5 (20%)
STKc_PAK4 300..591 CDD:132988 101/277 (36%)
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 98/260 (38%)
S_TKc 42..293 CDD:214567 97/256 (38%)
Mst1_SARAH 608..655 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.