DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TRAIP and CG7694

DIOPT Version :10

Sequence 1:NP_005870.2 Gene:TRAIP / 10293 HGNCID:30764 Length:469 Species:Homo sapiens
Sequence 2:NP_650729.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster


Alignment Length:79 Identity:18/79 - (22%)
Similarity:37/79 - (46%) Gaps:9/79 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     7 CTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIINKLFFDLAQEEE 71
            |::|.:..:..:....:.|.|.||.:|::.|.:  .:.:||.||.::.....:.:......|:|.
  Fly    70 CSVCKEPAEEGQKYRILPCKHEFHEECILLWLK--KTNSCPLCRYELETDDPVYEELRRFRQDEA 132

Human    72 N-------VLDAEF 78
            |       :||:.|
  Fly   133 NRRERENTLLDSMF 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TRAIPNP_005870.2 RING-H2_TRAIP 6..50 CDD:438143 10/42 (24%)
EnvC 65..>278 CDD:443969 6/21 (29%)
Interaction with CYLD. /evidence=ECO:0000269|PubMed:14676304 211..469
PIP-box. /evidence=ECO:0000269|PubMed:26711499 460..469
CG7694NP_650729.1 PEX10 <18..111 CDD:227861 10/42 (24%)
RING-H2_RNF181 69..114 CDD:438331 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.