DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TRAIP and CG10916

DIOPT Version :9

Sequence 1:	NP_005870.2	Gene:	TRAIP / 10293	HGNCID:	30764	Length:	469	Species:	Homo sapiens
Sequence 2:	NP_001261070.1	Gene:	CG10916 / 37081	FlyBaseID:	FBgn0034312	Length:	263	Species:	Drosophila melanogaster

Alignment Length:	100	Identity:	36/100 - (36%)
Similarity:	51/100 - (51%)	Gaps:	13/100 - (13%)

- Green bases have known domain annotations that are detailed below.

Human     3 IRALCTICSDFFDHSRDV--AAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIINKLFFD 65
            :..||.||::|| .:.|:  :...|||.||..||.:|...  ||||||||....:|. :::|:.:
  Fly    28 LNILCAICNEFF-RANDIIFSTSRCGHVFHKDCLTRWLNR--SRTCPQCRDPCDRRR-VHRLYLN 88

Human    66 LAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDS 100
            .|:..| ..|.|..|..:|.|...|.      |||
  Fly    89 FAEAPE-FDDTELPKVAMDWVPIDLD------RDS 116

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TRAIP	NP_005870.2	RING-H2_TRAIP	6..50	CDD:319394	21/45 (47%)
		RING-H2 finger (C3H2C3-type)	7..49	CDD:319394	19/43 (44%)
		SMC_N	<68..>279	CDD:330553	9/32 (28%)
		Interaction with CYLD. /evidence=ECO:0000269\|PubMed:14676304	211..469
		PIP-box. /evidence=ECO:0000269\|PubMed:26711499	460..469
CG10916	NP_001261070.1	zf-RING_2	32..74	CDD:290367	20/44 (45%)
		zf-rbx1	<32..74	CDD:289448	20/44 (45%)
		DM9	105..183	CDD:128937	5/17 (29%)
		DUF3421	133..246	CDD:288732
		DM9	186..254	CDD:128937
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	53	1.000	Domainoid score	I11352
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D581741at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.920