DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDKN2A and nas6

DIOPT Version :10

Sequence 1:XP_011515977.1 Gene:CDKN2A / 1029 HGNCID:1787 Length:184 Species:Homo sapiens
Sequence 2:NP_593722.1 Gene:nas6 / 2542919 PomBaseID:SPAC6C3.08 Length:234 Species:Schizosaccharomyces pombe


Alignment Length:86 Identity:29/86 - (33%)
Similarity:43/86 - (50%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    19 AAARGRVEEVRALLE-AGALPNAPNSYGRRPI-QVMMMGSARVAELLLLHGAEPNCADPATLTRP 81
            ||.:||:..|:.|.: |..|....:..|:.|: :...:|..:|.:.|:...|..|.:|....| |
pombe   114 AAGKGRLSIVQLLCDKAPELIRKKDLQGQTPLHRAAAVGKIQVVKYLISQRAPLNTSDSYGFT-P 177

Human    82 VHDAAREGFLDTLVVLHRAGA 102
            :|.|..||..|..|.|.||||
pombe   178 LHFALAEGHPDVGVELVRAGA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDKN2AXP_011515977.1 ANKYR <16..148 CDD:440430 29/86 (34%)
ANK repeat 16..42 CDD:293786 8/23 (35%)
ANK repeat 44..74 CDD:293786 7/30 (23%)
ANK repeat 76..108 CDD:293786 13/27 (48%)
nas6NP_593722.1 ANKYR <19..211 CDD:440430 29/86 (34%)
ANK repeat 36..68 CDD:293786
ANK repeat 71..104 CDD:293786
ANK repeat 107..138 CDD:293786 8/23 (35%)
ANK repeat 140..171 CDD:293786 7/30 (23%)
ANK repeat 173..204 CDD:293786 13/27 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.