DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDKN2A and F37A4.4

DIOPT Version :10

Sequence 1:XP_011515977.1 Gene:CDKN2A / 1029 HGNCID:1787 Length:184 Species:Homo sapiens
Sequence 2:NP_498471.1 Gene:F37A4.4 / 175945 WormBaseID:WBGene00018134 Length:1163 Species:Caenorhabditis elegans


Alignment Length:61 Identity:21/61 - (34%)
Similarity:30/61 - (49%) Gaps:6/61 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    25 VEEVRA--LLEA---GALPNAPNSYGRRPIQV-MMMGSARVAELLLLHGAEPNCADPATLT 79
            |.|:.|  ||:|   ||..|..|.||...:.| ...|...:.|:|:.|||:.:..:|...|
 Worm   832 VREINATNLLKAVKRGAYINVCNKYGNTALHVATRRGYQNLVEILIKHGADRSFLNPQNKT 892

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDKN2AXP_011515977.1 ANKYR <16..148 CDD:440430 21/61 (34%)
ANK repeat 16..42 CDD:293786 9/21 (43%)
ANK repeat 44..74 CDD:293786 9/30 (30%)
ANK repeat 76..108 CDD:293786 1/4 (25%)
F37A4.4NP_498471.1 WSN 27..95 CDD:197734
PHA02874 <778..>880 CDD:165205 16/47 (34%)
ANKYR <844..>896 CDD:440430 15/49 (31%)
ANK repeat 856..887 CDD:293786 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.