DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CWC27 and CG2852

DIOPT Version :10

Sequence 1:NP_005860.2 Gene:CWC27 / 10283 HGNCID:10664 Length:472 Species:Homo sapiens
Sequence 2:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster


Alignment Length:157 Identity:63/157 - (40%)
Similarity:86/157 - (54%) Gaps:13/157 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     9 PPTNGKVLLKTT-----AGDIDIELWSKEAPKACRNFIQLCLEAY---YDNTIFHRVVPGFIVQG 65
            |....||....|     ||.|:|.|:.|..||...||.:|.|:..   |..:.|||::..|::||
  Fly    25 PKVTEKVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQG 89

Human    66 GDPT-GTGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTI 129
            ||.| |.|:||.||||..|:|| :.:|:....|.::|||||...||||||.|..:...|:.:|.:
  Fly    90 GDFTKGDGTGGRSIYGERFEDE-NFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVV 153

Human   130 FGKV-TGDTVYNMLRLSEVDIDDDERP 155
            |||: :|..|...:..|..|..|  ||
  Fly   154 FGKILSGMNVVRQIENSATDARD--RP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CWC27NP_005860.2 cyclophilin_CeCYP16-like 8..178 CDD:238906 63/157 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..386
DUF5401 <302..>472 CDD:375164
CWC27_CTD 376..428 CDD:412084
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..472
CG2852NP_611695.1 cyclophilin 30..188 CDD:469651 62/152 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.