DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CWC27 and ninaA

DIOPT Version :10

Sequence 1:NP_005860.2 Gene:CWC27 / 10283 HGNCID:10664 Length:472 Species:Homo sapiens
Sequence 2:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster


Alignment Length:155 Identity:65/155 - (41%)
Similarity:81/155 - (52%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    18 KTTAGDIDIELWSKEAPKACRNFIQLCLEAY----YDNTIFHRVVPGFIVQGGD-PTGTGSGGES 77
            |...|.|...|:.|.|||...||..:||...    |..:.|||||..|:||||| ..|.|:|..|
  Fly    37 KKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSIS 101

Human    78 IYGAPFKDEFHS-RLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTG--DTVY 139
            |||..|.||..: .:..||.|.:.|||.|...||.||:.|...|..|:.|||:||||..  ||:|
  Fly   102 IYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIY 166

Human   140 NMLRLSEVDIDDDERPHNPHKIKSC 164
               .:.:|..|.|:.|..|..|.:|
  Fly   167 ---AIEDVKTDTDDFPVEPVVISNC 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CWC27NP_005860.2 cyclophilin_CeCYP16-like 8..178 CDD:238906 65/155 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..386
DUF5401 <302..>472 CDD:375164
CWC27_CTD 376..428 CDD:412084
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..472
ninaANP_476656.1 cyclophilin 27..189 CDD:469651 65/155 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.