DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BET1 and Bet1

DIOPT Version :9

Sequence 1:NP_005859.1 Gene:BET1 / 10282 HGNCID:14562 Length:118 Species:Homo sapiens
Sequence 2:NP_649096.1 Gene:Bet1 / 40094 FlyBaseID:FBgn0260857 Length:117 Species:Drosophila melanogaster


Alignment Length:108 Identity:43/108 - (39%)
Similarity:67/108 - (62%) Gaps:1/108 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    12 PGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTG 76
            |.|....|...:.:.|.|.|||:..|.|:.|:.|:|||:|:||:||:.|:|||..:|...|.|:|
  Fly    10 PLNQHPSGPHPASHDALEAENEQAAEELKQKIGALKSLTIDIGNEVRYQDKLLRGIDDDMDRTSG 74

Human    77 FLGKTMGK-LKILSRGSQTKLLCYMMLFSLFVFFIIYWIIKLR 118
            |||..|.: :::..:|...:.:|||.||.|.||.|::..:|.:
  Fly    75 FLGNAMTRVVRLAKQGGGARQMCYMFLFILVVFLILWITLKFK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BET1NP_005859.1 SNARE_Bet1 29..87 CDD:277206 28/58 (48%)
Bet1NP_649096.1 SNARE_Bet1 38..85 CDD:277206 22/46 (48%)
SNARE 65..111 CDD:283412 18/45 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3385
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38108
Inparanoid 1 1.050 84 1.000 Inparanoid score I5186
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52359
OrthoDB 1 1.010 - - D1450835at2759
OrthoFinder 1 1.000 - - FOG0002142
OrthoInspector 1 1.000 - - oto90068
orthoMCL 1 0.900 - - OOG6_101026
Panther 1 1.100 - - LDO PTHR12791
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R135
SonicParanoid 1 1.000 - - X6161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.