DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NET1 and trio

DIOPT Version :9

Sequence 1:NP_001040625.1 Gene:NET1 / 10276 HGNCID:14592 Length:596 Species:Homo sapiens
Sequence 2:NP_651960.2 Gene:trio / 43974 FlyBaseID:FBgn0024277 Length:2263 Species:Drosophila melanogaster


Alignment Length:480 Identity:103/480 - (21%)
Similarity:188/480 - (39%) Gaps:94/480 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   114 RRFGQTIQSFTLRGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRRQEA 178
            :..|.:.|...|..|..|..|:......|.....||..||...::.::...::|     .||:|.
  Fly  1227 KSLGMSQQQLLLGSDGNSSISSSSGDRHSDPTLEAKLNSSNKENKEINEEKRKS-----ARRKEF 1286

Human   179 IY-EMSRGEQDLIEDLKLARKAYHDPM-----LKLSIMSEEELTHIFGDLDSYIPLHEDLLTRIG 237
            |. |:.:.|:..:.||....|.:.:..     :..:::.:|::  |||::......|:.:..|  
  Fly  1287 IMAELMQTERAYVNDLATCIKCFLEEFRAGKSVPSALIGQEDV--IFGNIKEIHHFHQKIFLR-- 1347

Human   238 EATKPDGTVEQIGHILVSWLPRLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSRKL 302
            |..|.:...|.:||..|:|..:.:.|..||.|:..:..||.|  ......:.|||.||      :
  Fly  1348 ELEKYETMPEDVGHCFVTWASKFDMYVHYCKNKPTSNNLLVQ--HGGSFFEELQRRLE------V 1404

Human   303 D--LWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDAILIIQGVLSDINLKKGESE---- 361
            |  |.::|..|..|:.||.||||::|....:.|.:::         :|:...:|:.|..::    
  Fly  1405 DHPLPAYLIKPVQRITKYQLLLKDLLSCCEESHGEIK---------EGLEVMLNVPKKANDAMHL 1460

Human   362 -----CQYYIDKLEYLDEKQRDPRIEASKVLLCHGELRSKSGHKLYIFLFQDILVLTRPVTRNER 421
                 |...:|||..:..:......:..:::        :.|.:..:|||:..|:..:.|..:..
  Fly  1461 SLLENCDVSVDKLGEVVLQDAFQAWDTKQII--------RKGRERRVFLFELYLLFAKEVKESNV 1517

Human   422 HSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSEKAKNIFRIRFHDPSPAQSH---TLQA 483
            ..|| ::..:...::.:.:..:||......:.|.                  ||..|.   .|:|
  Fly  1518 VKYQ-FKSKLMTTDMGITEHIEGDETKFAVWTGR------------------SPMLSDCRIVLKA 1563

Human   484 NDVFHKQQWFNCIRAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRASTVSSVTQVE 548
            ..:..||.|...:|..:.....:|:...|...|..|.  ..:..|:|.|..|             
  Fly  1564 TSLETKQIWVKKLREVMQETCFSGTSLTLPKSPAKHS--GSSQRSSRDLDEQ------------- 1613

Human   549 VDENAY-RC-----GSGMQMAEDSK 567
            :.||.: ||     |||.....|:|
  Fly  1614 LTENDHDRCSLASFGSGNTTDSDNK 1638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NET1NP_001040625.1 Necessary for nuclear localization. /evidence=ECO:0000250 1..74
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Nuclear localization signal. /evidence=ECO:0000250 12..19
Nuclear localization signal. /evidence=ECO:0000250 66..72
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..146 4/18 (22%)
RhoGEF 178..354 CDD:214619 45/183 (25%)
PH_Net1 368..502 CDD:270044 22/136 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 562..596 2/6 (33%)
trioNP_651960.2 SEC14 13..152 CDD:214706
SPEC 314..>468 CDD:238103
SPEC 563..778 CDD:238103
SPEC 782..997 CDD:238103
SPEC 897..1119 CDD:238103
SPEC 1125..1226 CDD:197544
RhoGEF 1287..1456 CDD:279015 47/189 (25%)
PH1_Kalirin_Trio_like 1462..1584 CDD:270060 24/148 (16%)
PH 1495..1580 CDD:278594 19/103 (18%)
SH3_Kalirin_1 1643..1707 CDD:212786
RhoGEF 1945..2122 CDD:279015
PH2_Kalirin_Trio_p63RhoGEF 2130..2260 CDD:270061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3601
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.