DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and CG34297

DIOPT Version :10

Sequence 1:NP_005852.2 Gene:STUB1 / 10273 HGNCID:11427 Length:303 Species:Homo sapiens
Sequence 2:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster


Alignment Length:138 Identity:35/138 - (25%)
Similarity:61/138 - (44%) Gaps:13/138 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     6 EKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCY 70
            ::...|||       |:...||..::.||..:....|..|...|..||.......:.|.|||||:
  Fly   106 DQRSKARL-------ERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYINRALCF 163

Human    71 LKMQQHEQALADCRRAL-ELDGQSVKAHFFLGQCQ--LEMESYDEAIANLQRAYSLAKEQRLNFG 132
            :|..:.::.:.||...| :||.::::|..:.....  |..||..|......|.::   .::::|.
  Fly   164 IKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLNDESNFENCVKYARKFN---SKQMDFI 225

Human   133 DDIPSALR 140
            ||....|:
  Fly   226 DDFLEKLK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_005852.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 6/23 (26%)
Spy 25..>124 CDD:443119 27/101 (27%)
TPR 1 26..59 9/32 (28%)
TPR repeat 26..54 CDD:276809 8/27 (30%)
TPR repeat 59..89 CDD:276809 10/30 (33%)
TPR 2 60..93 12/33 (36%)
TPR repeat 94..122 CDD:276809 6/29 (21%)
TPR 3 95..127 6/33 (18%)
Required for interaction with MAPK7. /evidence=ECO:0000269|PubMed:20724525 101..200 9/42 (21%)
CHIP_TPR_N 142..225 CDD:436460
Required for interaction with and ubiquitination of MYOCD. /evidence=ECO:0000250|UniProtKB:A6HD62 142..196
Required for ubiquitination of FOXO1. /evidence=ECO:0000269|PubMed:19483080 143..303
Required for interaction with FOXO1. /evidence=ECO:0000269|PubMed:19483080 143..197
RING-Ubox_CHIP 227..297 CDD:438316
CG34297NP_001097696.1 NlpI <104..>203 CDD:443815 27/103 (26%)
TPR repeat 119..147 CDD:276809 8/27 (30%)
TPR repeat 152..183 CDD:276809 10/30 (33%)
TPR repeat 188..216 CDD:276809 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.