DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and Spag1

DIOPT Version :10

Sequence 1:NP_005852.2 Gene:STUB1 / 10273 HGNCID:11427 Length:303 Species:Homo sapiens
Sequence 2:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster


Alignment Length:200 Identity:46/200 - (23%)
Similarity:95/200 - (47%) Gaps:29/200 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    21 EKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVY-YTNRALCYLKMQQHEQALADCR 84
            ||...|:..:.:||..|..::|..|...|..:|..:|..||: |.|||:.:||::::..|::||:
  Fly   224 EKEQFAERHRLRGNESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQ 288

Human    85 RALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNS 149
            ..|::|..::|||..:.:.......:.|::    ..|    ::.|:|..|             |:
  Fly   289 ACLQIDPMNIKAHLRMAEAHNAEGKHLESL----NVY----KKLLDFEPD-------------NA 332

Human   150 IEERRIHQESEL-----HSYLSRLIAAERE-RELEECQRNHEGDEDD-SHVRAQQACIEAKHDKY 207
            |.::.:.:.:.:     .|..:|||..|.: .:|:..:...|.::.: :.|:..:..:.||....
  Fly   333 IAKKAVEKLTSMLGEVAPSSATRLIIEEIDPPQLKTSEPKKEAEKSEPTVVKKPEPVVSAKKPPP 397

Human   208 MADMD 212
            :.|.|
  Fly   398 IKDYD 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_005852.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 3/8 (38%)
Spy 25..>124 CDD:443119 27/99 (27%)
TPR 1 26..59 9/32 (28%)
TPR repeat 26..54 CDD:276809 7/27 (26%)
TPR repeat 59..89 CDD:276809 12/30 (40%)
TPR 2 60..93 13/33 (39%)
TPR repeat 94..122 CDD:276809 4/27 (15%)
TPR 3 95..127 5/31 (16%)
Required for interaction with MAPK7. /evidence=ECO:0000269|PubMed:20724525 101..200 15/105 (14%)
CHIP_TPR_N 142..225 CDD:436460 13/77 (17%)
Required for interaction with and ubiquitination of MYOCD. /evidence=ECO:0000250|UniProtKB:A6HD62 142..196 10/60 (17%)
Required for ubiquitination of FOXO1. /evidence=ECO:0000269|PubMed:19483080 143..303 13/76 (17%)
Required for interaction with FOXO1. /evidence=ECO:0000269|PubMed:19483080 143..197 10/60 (17%)
RING-Ubox_CHIP 227..297 CDD:438316
Spag1NP_651514.1 NlpI <229..373 CDD:443815 38/164 (23%)
TPR repeat 229..257 CDD:276809 7/27 (26%)
TPR repeat 262..293 CDD:276809 12/30 (40%)
TPR repeat 298..326 CDD:276809 5/35 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.