DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STUB1 and CG31294

DIOPT Version :10

Sequence 1:NP_005852.2 Gene:STUB1 / 10273 HGNCID:11427 Length:303 Species:Homo sapiens
Sequence 2:NP_732055.1 Gene:CG31294 / 318666 FlyBaseID:FBgn0051294 Length:225 Species:Drosophila melanogaster


Alignment Length:108 Identity:29/108 - (26%)
Similarity:47/108 - (43%) Gaps:6/108 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    26 AQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRAL-EL 89
            |...:..||..:....|.:|...|.:||.......|.|.||||..:|.:..:.||.|....: .|
  Fly   106 ADSFRRLGNEEYRRTNYEKAVYFYSKAIQYVADSPVLYCNRALAKIKKRDFKLALFDLDYVIFNL 170

Human    90 DGQSVKAHFF----LGQCQLEMESYDEAIANLQRAYSLAKEQR 128
            |...::|..:    |.:...|.| ::.||||.:......|:::
  Fly   171 DPIHLRAWLYRAGALARLNNESE-FEIAIANARLLNRSQKDKK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STUB1NP_005852.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 1/3 (33%)
Spy 25..>124 CDD:443119 28/102 (27%)
TPR 1 26..59 8/32 (25%)
TPR repeat 26..54 CDD:276809 7/27 (26%)
TPR repeat 59..89 CDD:276809 10/30 (33%)
TPR 2 60..93 12/33 (36%)
TPR repeat 94..122 CDD:276809 8/31 (26%)
TPR 3 95..127 9/35 (26%)
Required for interaction with MAPK7. /evidence=ECO:0000269|PubMed:20724525 101..200 7/28 (25%)
CHIP_TPR_N 142..225 CDD:436460
Required for interaction with and ubiquitination of MYOCD. /evidence=ECO:0000250|UniProtKB:A6HD62 142..196
Required for ubiquitination of FOXO1. /evidence=ECO:0000269|PubMed:19483080 143..303
Required for interaction with FOXO1. /evidence=ECO:0000269|PubMed:19483080 143..197
RING-Ubox_CHIP 227..297 CDD:438316
CG31294NP_732055.1 NlpI <106..>199 CDD:443815 25/93 (27%)
TPR repeat 106..134 CDD:276809 7/27 (26%)
TPR repeat 139..170 CDD:276809 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.