DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LOC102723502 and actc2

DIOPT Version :9

Sequence 1:NP_001382398.1 Gene:LOC102723502 / 102723502 -ID:- Length:581 Species:Homo sapiens
Sequence 2:NP_001002066.1 Gene:actc2 / 570210 ZFINID:ZDB-GENE-040625-35 Length:377 Species:Danio rerio


Alignment Length:302 Identity:60/302 - (19%)
Similarity:104/302 - (34%) Gaps:90/302 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    34 CCRGSGKSNMGTSGDHDDSFMKTLRSKMGKCCHHCFPCCRGSGTSNVGTSGDHDNSFMKTLRSKM 98
            |..|||....|.:|  ||:......|.:|:..|.......|...|.||.........: ||:   
Zfish    12 CDNGSGLVKAGFAG--DDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL-TLK--- 70

Human    99 GKWCCHCFPCCRGSGKSNVGTWGDYDDSAFMEPRYHVRREDLDKLHRAAWWG--KVPRKDLIVML 161
                   :|...|.    :..|                 :|::|:....::.  :|..::...:|
Zfish    71 -------YPIEHGI----ITNW-----------------DDMEKIWHHTFYNELRVAPEEHPTLL 107

Human   162 RDTDMN-KRDKQKRTALHLASANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAVQCQEDECVLML 225
            .:..:| |.:::|.|              |::.:   ..||      .|:..|:|     .||.|
Zfish   108 TEAPLNPKANREKMT--------------QIMFE---TFNV------PAMYVAIQ-----AVLSL 144

Human   226 LEHGADGNIQDEYGNTALHYAIYNEDKLMAKALL---LYGADIESKNKCGLTPLLLGVHEQK--- 284
            ...|....|..:.|:...|.....|...:..|::   |.|.|        ||..|:.:..::   
Zfish   145 YASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRD--------LTDYLMKILTERGYS 201

Human   285 ------QEVVKFLIKKKANLNALDRYGRTALILAVCCGSASI 320
                  :|:|:. ||:|....|||....    :|....|:|:
Zfish   202 FVTTAEREIVRD-IKEKLCYVALDFENE----MATAASSSSL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LOC102723502NP_001382398.1 None
actc2NP_001002066.1 PTZ00281 4..377 CDD:173506 60/302 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100127
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.