DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IRX5 and Drgx

DIOPT Version :9

Sequence 1:NP_005844.4 Gene:IRX5 / 10265 HGNCID:14361 Length:483 Species:Homo sapiens
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:450 Identity:107/450 - (23%)
Similarity:149/450 - (33%) Gaps:115/450 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    89 HTPGMAGSLGYHPYAA--PLGSYPYGDPAY-------RKNATRDATATLK-------AWLNEHRK 137
            |.|.:. :|.| |:||  |..||.| .||.       ||......|.||:       |:...|  
  Fly    16 HPPRLP-TLDY-PFAATHPYTSYSY-HPAIHDETFVRRKQRRNRTTFTLQQLEELETAFAQTH-- 75

Human   138 NPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWTPRNRSEDEEEEENIDLEKNDED 202
              ||....:..||:...:|..:|..||.|.|.:.:|..::....|.|   |..|.:..|:|..:.
  Fly    76 --YPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLKDEQRKR---ENGESSSSLDKLHDS 135

Human   203 EPQKPEDKGD-------------PEGPEAGGAEQKAASGCERLQGPPTPAGKETEGSLSDSDFKE 254
            ....|:..|:             ...|.|.|..::..|.........:|.|..   .|..||.:.
  Fly   136 RESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHSHSRSPGGGM---HLDSSDNER 197

Human   255 PPSEGRLDALQ-------GPPRTGGPSPAGPAAARLAEDPAPHYP-AGAPAPGPHPAAG----EV 307
            |.|..:|.|..       |....|.|||:|....|      .|.| .|....||...:.    :.
  Fly   198 PLSSNQLTATPHSASQSLGSISAGSPSPSGMHRER------EHTPLVGGGGQGPSSPSNSRNTDS 256

Human   308 PPGPGGPSVI--------------HSPPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGNEGSP 358
            |...|||..:              .|.|.|..|.....|...:.|..|..|....:.|||:..|.
  Fly   257 PIEVGGPMSLTTGSRMAASSNNSASSTPTPTTPHAPQMPHSSAAAAAAFGSHIFGNFGGGSNASD 321

Human   359 CPPCPGPIAGQALGGSRASPAPAPSRSPSAQCPFPGGTVLSRPLY--------YT-APFYPGYTN 414
            ......|:..:....:.|:.|.|..|  ||..|         ||:        :| .|.:||...
  Fly   322 SNCGFRPVLSEQSAVAAAAAAAAAQR--SANHP---------PLFLPPHLAAQFTHQPLFPGLKG 375

Human   415 YGSFGHLHG----HPGPGPG-----PTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQ 465
            ...|..|..    .|.|.||     |.:.|.|            :.:.|..|:..:|..|
  Fly   376 VSPFQSLCSCCSLKPPPPPGSSVVAPLSIPVS------------SSSAASSPESPKSSGQ 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IRX5NP_005844.4 Homeobox_KN 131..170 CDD:283551 11/38 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..392 56/253 (22%)
IRO 327..344 CDD:214716 3/16 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..442 7/27 (26%)
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 15/55 (27%)
OAR 428..445 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.