DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IRX5 and achi

DIOPT Version :9

Sequence 1:NP_005844.4 Gene:IRX5 / 10265 HGNCID:14361 Length:483 Species:Homo sapiens
Sequence 2:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster


Alignment Length:296 Identity:76/296 - (25%)
Similarity:98/296 - (33%) Gaps:102/296 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   117 RKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWTP 181
            |.|..:.:...||.||.|||.|.||:..||..|:....:|:.||..||.|||||:.         
  Fly    97 RGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRIL--------- 152

Human   182 RNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPEAGGAEQKAASGCER-------LQGP---- 235
                     .|.|..|.|            ||.........:|.:..|.|       |.||    
  Fly   153 ---------PEMIRREGN------------DPLHFTISRRGKKVSPNCSRSSALGANLTGPNPAH 196

Human   236 PTPAGKETEGSLSDSDFKEPPSEGRLDAL-------QGPPRTGGPSPAGPAAARLAEDPAPHYPA 293
            .:||.:...|:..:.|......||..:.|       |||  .|......|.    .||...:...
  Fly   197 GSPASEVVVGATEEVDGAGEIHEGIANVLTNFEQYVQGP--NGQMVKMEPE----YEDSVIYSWQ 255

Human   294 GAPAPGPHPAAGEVPPGPGGPSVIHSPPPPPPPAVLAKPKLWSLAEIATSSDKVKDG-------- 350
            .|           :...|.|...:||                ||.  ||..||:|:.        
  Fly   256 QA-----------IANNPMGFQSLHS----------------SLQ--ATMIDKIKNYQMRKAAAI 291

Human   351 GGGNEGSPCPPCPGPIAGQALGGSRASPAPAPSRSP 386
            ||...||          |.| |||.::.:||.|..|
  Fly   292 GGSAVGS----------GGA-GGSSSNSSPATSILP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IRX5NP_005844.4 Homeobox_KN 131..170 CDD:283551 19/38 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..392 51/236 (22%)
IRO 327..344 CDD:214716 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..442
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 19/38 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.