DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK2AP2 and CG15142

DIOPT Version :10

Sequence 1:NP_005842.1 Gene:CDK2AP2 / 10263 HGNCID:30833 Length:126 Species:Homo sapiens
Sequence 2:NP_609846.1 Gene:CG15142 / 35059 FlyBaseID:FBgn0032645 Length:206 Species:Drosophila melanogaster


Alignment Length:53 Identity:24/53 - (45%)
Similarity:33/53 - (62%) Gaps:5/53 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    74 YTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECL-----AETE 121
            |:|||:|:.||...:..|.||.::..||::|.|.|||..||:||     ||.|
  Fly   141 YSDLLNVLGEMRTNVPTTMAGLRAPKERMQRDIAHARLKVRQCLQLLQQAEEE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK2AP2NP_005842.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
rad23 <5..>106 CDD:273167 13/31 (42%)
Interaction with CDK2. /evidence=ECO:0000269|PubMed:23781148 64..106 13/31 (42%)
CDK2AP <73..125 CDD:430840 24/53 (45%)
CG15142NP_609846.1 CDK2AP 1..192 CDD:430840 22/50 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.