DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDKN1A and dap

DIOPT Version :9

Sequence 1:NP_001278478.1 Gene:CDKN1A / 1026 HGNCID:1784 Length:198 Species:Homo sapiens
Sequence 2:NP_476948.1 Gene:dap / 36001 FlyBaseID:FBgn0010316 Length:245 Species:Drosophila melanogaster


Alignment Length:212 Identity:52/212 - (24%)
Similarity:73/212 - (34%) Gaps:67/212 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    30 FCSGAMSEPAGDVRQNPCG---SKACRRLFG------------PVDSEQLSRDCDALMAGCIQE- 78
            ||.  ||......|...||   ::..|.|||            |.:|| |.|.         || 
  Fly    15 FCK--MSSSPAVSRNLACGRQLNRIKRDLFGSSKSAEGTANKTPFNSE-LERH---------QEL 67

Human    79 ARERWNFDFVTETPL--EGDFAWERV---RGLGLPKLYLPT--------------------GPRR 118
            |.::|.|||....||  :..:.||||   .....|::|..|                    ..|.
  Fly    68 ATQKWGFDFRAGCPLAEKSPYIWERVSFQESSFAPEMYTLTRAAHVRPSADASPSDMDILVNERS 132

Human   119 GRDELGGGRRPGTSPALLQGTAEE---DHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTS 180
            .|:..|...   .:.:|...|..|   |..|.||:..|...|....        .|...::||..
  Fly   133 ERENFGSNL---VNSSLESNTDNESCYDSQDESLAMRLSSSSTTST--------SSIVLRKRQPK 186

Human   181 MTDFYHSKRRLIFSKRK 197
            :|:|...::||..:.:|
  Fly   187 ITEFMKERKRLAQAPKK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDKN1ANP_001278478.1 CDI 55..100 CDD:366992 17/59 (29%)
dapNP_476948.1 CDI 41..83 CDD:280409 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4743
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.