DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK9 and CG6800

DIOPT Version :10

Sequence 1:NP_001252.1 Gene:CDK9 / 1025 HGNCID:1780 Length:372 Species:Homo sapiens
Sequence 2:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster


Alignment Length:190 Identity:42/190 - (22%)
Similarity:76/190 - (40%) Gaps:59/190 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   649 HARIKRLCAQNE-KDEEQ--KTAYYLE------------------MYS--LSQKAISEEEELFHR 690
            ::.|.|:.||:: |..||  :.||.::                  :|.  :|.:.|.||.. ::.
  Fly    59 NSMIARMFAQDQLKPAEQDGQGAYLIDRNGHYFRPILDYLRHGRVIYDPHVSLQGILEEAR-YYG 122

Human   691 VQGMLSLQDLQNINSPLMRRLARLKLSLAETCLELLQ--IVCKETLELQ-----MEQNSFEKLLA 748
            :.|:          :.|::.:.|..:||  |.|:.::  :....|.||:     :...:..||  
  Fly   123 LDGL----------ARLIQEIERADVSL--TRLDFIRTLVTSSHTTELRFQGVHLSGINLSKL-- 173

Human   749 DFLQNTS---------DYSSIGLQWFFLKRTLPHLVLAQLE--SLHPLCVGCMDIRAQLL 797
             .|:|.:         :.|...|.|..|:|.  .|..|.||  .||.:...|.|::...|
  Fly   174 -DLRNINFKYACLSHCNLSYANLSWCCLERA--ELRCANLEGAKLHSVMAACADLQGAKL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK9NP_001252.1 STKc_CDK9 6..315 CDD:270848
T-loop 166..191
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..372
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 42/190 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.