DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC17A2 and dmGlut

DIOPT Version :9

Sequence 1:NP_001273052.1 Gene:SLC17A2 / 10246 HGNCID:10930 Length:478 Species:Homo sapiens
Sequence 2:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster


Alignment Length:468 Identity:146/468 - (31%)
Similarity:239/468 - (51%) Gaps:27/468 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    17 RYGLALIMHFSNFTMITQRVSLSI-AIIAMVNT-TQQQGLSNASTEGPV-ADAFNNSSISIKE-- 76
            ::|::|    |.:.:|.|||.|:| ..:|::|. |.:..||.|.|...| .::.::.|.:|.|  
  Fly     6 QWGISL----SRYFVIPQRVILAIMGFLAILNAYTMRVCLSQAITVLVVKKNSTDDDSEAICEPD 66

Human    77 -FDTKASV---YQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKKMLGAGLLISSLLTLFTP 137
             .|...||   ::||.|.||:|.||...|.|:|.||.|.||..||.|..||.|:|.:::.|:.||
  Fly    67 DIDEGTSVGGDFEWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTP 131

Human   138 LAADFG-VILVIMVRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTTIAGSGSAFGSFIILCVGG 201
            ||.:.| ...:|:.|.:.|:.:|..:.....:.|.|.|..||.||..:...|...|:.:...:.|
  Fly   132 LAINKGDSDWLIVTRVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSG 196

Human   202 LISQALSWPFIFYIFGSTGCVCCLLWFTVI----YDDPMHHPCISVREKEHI---LSSLAQQPSS 259
            :...|..|.|:||.||..|.|    ||.:.    |.||..||.|...|:|::   :.::::....
  Fly   197 VFIDAYGWEFVFYFFGGLGVV----WFAIFMFLCYSDPTSHPFIKPSEREYLVKEIGTISRNEDL 257

Human   260 PGRAVPIKAMVTCLPLWAIFLGFFSHFWLCTIILTYLPTYISTLLHVNIRDSGVLSSLPFIAAAS 324
            |  ..|.||::|.||::|:......|.|...|::|.||.|::.:|..:|:.:|:.||||::....
  Fly   258 P--PTPWKAILTNLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWI 320

Human   325 CTILGGQLADFLLSRNLLRLITVRKLFSSLGLLLPSICAVALPFVASSYVITIILLILIPGTSNL 389
            .::..|.:||:::.|.:|.....||:.:.|....|:|..|...:.....|:.::|..:..|....
  Fly   321 VSVGSGFVADWMIRRGVLSTTNTRKVMTGLAAFGPAIFMVGASYAGCDRVLVVVLFTICMGLMGA 385

Human   390 CDSGFIINTLDIAPRYASFLMGISRGFGLIAGIISSTATGFLISQDFESGWRNVFFLSAAVNMFG 454
            ..:|..::.||::|.||..||.|:.|.|.|.|:|:....|.:........||.||:::..|..|.
  Fly   386 YYAGMKLSPLDMSPNYAGTLMAITNGIGAITGVITPYLVGVMTPNASLLEWRLVFWVAFGVLCFT 450

Human   455 LVFYLTFGQAELQ 467
            .|.|..:...|:|
  Fly   451 AVIYCIWASGEVQ 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC17A2NP_001273052.1 2A0114euk 1..477 CDD:129972 146/468 (31%)
MFS 81..461 CDD:119392 123/390 (32%)
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 137/443 (31%)
MFS 77..458 CDD:119392 121/386 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148703
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D347586at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.