DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIMM17B and Tim17a1

DIOPT Version :9

Sequence 1:NP_001161419.1 Gene:TIMM17B / 10245 HGNCID:17310 Length:222 Species:Homo sapiens
Sequence 2:NP_001287301.1 Gene:Tim17a1 / 41500 FlyBaseID:FBgn0038018 Length:222 Species:Drosophila melanogaster


Alignment Length:186 Identity:78/186 - (41%)
Similarity:98/186 - (52%) Gaps:50/186 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     3 EYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVCRLLSEAPLFIYSCSRSVSPTVNVS 67
            ||.|:|||.|||:|||.||.||.|||.:|:.:|||||||.                         
  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTIGGSLFEFLKGFRNAPT------------------------- 41

Human    68 SERAESRPTLFMAVSLHMAWCLAHIGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVR 132
                                     |::.||.|..:.|::|.|.|.|||||||..|||:||.||.
  Fly    42 -------------------------GLQRRLYGGIDLVKMRTPSIAGSFAVWGATFSTVDCALVH 81

Human   133 LRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTA 188
            .|.:||.||||.|||.||.:||||:|..||..||::|.::||:|||.|..:....|
  Fly    82 YRQREDAWNSILSGAATGGILAARNGIRAMANSALVGCLVLAMIEGAGAAVATINA 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIMM17BNP_001161419.1 Tim17 1..221 CDD:295283 78/186 (42%)
Tim17a1NP_001287301.1 Tim17 2..138 CDD:295283 78/186 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152394
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.