DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIMM17B and Tim23

DIOPT Version :9

Sequence 1:NP_001161419.1 Gene:TIMM17B / 10245 HGNCID:17310 Length:222 Species:Homo sapiens
Sequence 2:NP_001015387.1 Gene:Tim23 / 3355096 FlyBaseID:FBgn0267976 Length:206 Species:Drosophila melanogaster


Alignment Length:112 Identity:29/112 - (25%)
Similarity:49/112 - (43%) Gaps:34/112 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   100 GSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVR--LRGKEDPWNSITSGALTGAVLAARSGPLAM 162
            |:||.:        |:..|   |:|.  ||::.  .||::|..|::.:|:.||.:..:.:|    
  Fly   123 GTANTL--------GTLTV---LYSA--CGVLLQFFRGEDDHINTVIAGSATGLLYKSTAG---- 170

Human   163 VGSAMMGGILLALIEGVGI--LLTRYTAQQFRNAPPFLEDPSQLPPK 207
            :.:...||.:     |:||  |...|...|        |:.|...||
  Fly   171 LRTCAFGGAI-----GLGISSLYCLYLIAQ--------ENSSNSSPK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIMM17BNP_001161419.1 Tim17 1..221 CDD:295283 29/112 (26%)
Tim23NP_001015387.1 Tim17 42..188 CDD:295283 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.