DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIMM17B and CG1724

DIOPT Version :9

Sequence 1:NP_001161419.1 Gene:TIMM17B / 10245 HGNCID:17310 Length:222 Species:Homo sapiens
Sequence 2:NP_608439.2 Gene:CG1724 / 33097 FlyBaseID:FBgn0031164 Length:185 Species:Drosophila melanogaster


Alignment Length:230 Identity:102/230 - (44%)
Similarity:129/230 - (56%) Gaps:60/230 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVCRLLSEAPLFIYSCSRSVSPTVN 65
            ||||:|||||:|||||||||||||..|||:||.:|||||||.                       
  Fly     1 MEEYSREPCPFRIVDDCGGAFTMGCFGGGLFQGLKGFRNAPQ----------------------- 42

Human    66 VSSERAESRPTLFMAVSLHMAWCLAHIGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGL 130
                                       |::.|..|...||:.|:|.|||:||.||.:||.:||.|
  Fly    43 ---------------------------GLKRRFAGGLAAVKSRSPTIGGNFAAWGCVFSIVDCSL 80

Human   131 VRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAP 195
            |.||.||||||||.|||:.|.:|::|:|..||.|||::||:||::|||||||.||.:|:||||:.
  Fly    81 VHLRKKEDPWNSIMSGAIAGGILSSRNGVAAMFGSAIIGGVLLSMIEGVGILFTRISAEQFRNSD 145

Human   196 P--------FLEDPSQLPPKDGTPAPG--YPSYQQ 220
            |        .....|.:...|...:||  :|..||
  Fly   146 PQNDLGRAGAFASGSGMGSGDINSSPGFEFPVVQQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIMM17BNP_001161419.1 Tim17 1..221 CDD:295283 102/230 (44%)
CG1724NP_608439.2 Tim17 1..147 CDD:295283 94/195 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152397
Domainoid 1 1.000 168 1.000 Domainoid score I3821
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3506
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 1 1.010 - - QHG54844
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm8479
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.720

Return to query results.
Submit another query.