DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP3S2 and or

DIOPT Version :9

Sequence 1:NP_005820.1 Gene:AP3S2 / 10239 HGNCID:571 Length:193 Species:Homo sapiens
Sequence 2:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster


Alignment Length:193 Identity:147/193 - (76%)
Similarity:169/193 - (87%) Gaps:7/193 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIY 65
            ||:|||||||||||||.:|||.|.|.:||||::|||.||.|||||:|||||||||||||||||||
  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65

Human    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVL 130
            |||||||||||||||||||||||||||||||||||||||||||||||.|.||:||.|:|||||||
  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130

Human   131 ETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV 193
            :||||:|:|:||.||::.|.|.|:||||||||||||::|:|:     .|.|  ||:|:|.|.:
  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQ-----QIKD--IKLPDLPQAI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP3S2NP_005820.1 AP3_sigma 1..146 CDD:341438 122/144 (85%)
orNP_536793.1 AP3_sigma 1..146 CDD:341438 122/144 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148029
Domainoid 1 1.000 259 1.000 Domainoid score I2003
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100592
Inparanoid 1 1.050 297 1.000 Inparanoid score I2735
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002758
OrthoInspector 1 1.000 - - otm40337
orthoMCL 1 0.900 - - OOG6_102376
Panther 1 1.100 - - LDO PTHR11753
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R65
SonicParanoid 1 1.000 - - X1844
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.