DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPR and GBP2

DIOPT Version :9

Sequence 1:NP_001095868.1 Gene:HNRNPR / 10236 HGNCID:5047 Length:636 Species:Homo sapiens
Sequence 2:NP_009916.1 Gene:GBP2 / 850346 SGDID:S000000517 Length:427 Species:Saccharomyces cerevisiae


Alignment Length:250 Identity:55/250 - (22%)
Similarity:92/250 - (36%) Gaps:51/250 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   246 NRLFVGSIPKNKTKENILEEFSKVTGLTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQA-- 308
            |.:||.::..:.|.|::.|.|..|..:.|  .|:|     ..|..:||...:|:..::|...|  
Yeast   122 NSIFVRNLTFDCTPEDLKELFGTVGEVVE--ADII-----TSKGHHRGMGTVEFTKNESVQDAIS 179

Human   309 --------RRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVK--------VLFVRNLATTVTE 357
                    .|:||            |...:|..|...|...|..        .:|:.||..::..
Yeast   180 KFDGALFMDRKLM------------VRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNW 232

Human   358 EILEKSFSEFGKLERVKKLKD-------YAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPP 415
            :.|:..|.|.|.:.|.....|       :..|.:......::|:|..||.|:||..:|:...:..
Yeast   233 QSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFN 297

Human   416 DKKRKERQAAR----QASRST---AYEDYYYHPPPRMPPPIRGRGRGGGRGGYGY 463
            .:|..:|...|    :.:|.|   ..:|...|..........|...||.|..:.|
Yeast   298 KRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPRNP_001095868.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
NURR_hnRNPR 27..110 CDD:410955
hnRNP-R-Q 106..631 CDD:273732 54/249 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..459 10/50 (20%)
Nuclear localization signal. /evidence=ECO:0000255 415..421 1/5 (20%)
RNA-binding RGG-box 450..570 4/13 (31%)
3 X 11 AA approximate repeats of D-D-Y-Y-G-Y-D-Y-H-D-Y 465..500
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 504..636
GBP2NP_009916.1 RRM1_HRB1_GBP2 121..197 CDD:410184 21/93 (23%)
RRM2_HRB1_GBP2 218..292 CDD:410185 18/73 (25%)
RRM3_HRB1_GBP2 347..425 CDD:410186 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.