DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPR and maca

DIOPT Version :10

Sequence 1:XP_047280655.1 Gene:HNRNPR / 10236 HGNCID:5047 Length:661 Species:Homo sapiens
Sequence 2:NP_650473.1 Gene:maca / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:104 Identity:22/104 - (21%)
Similarity:36/104 - (34%) Gaps:38/104 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    49 CTFLVSERHAGSHSL------------------W--------------KSYLDILPKSYTCPVCL 81
            |||: .::|:||.|:                  |              |.:.:.|...|:....|
  Fly     8 CTFM-GQKHSGSVSVEKKNQENDGPPTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENIL 71

Human    82 EPEVVDLLPGPLRAKAEEQRARVQDLFASSRDFFSTLQP 120
            ..:..:.|.....|:..|::||:     ...||.|.|.|
  Fly    72 FWQACEELKREKNAEKIEEKARI-----IYEDFISILSP 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPRXP_047280655.1 NURR_hnRNPR 52..135 CDD:410955 19/101 (19%)
hnRNP-R-Q 131..656 CDD:273732
macaNP_650473.1 sex-lethal <41..>210 CDD:273740 14/70 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.