DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPR and hnrnpr

DIOPT Version :9

Sequence 1:NP_001095868.1 Gene:HNRNPR / 10236 HGNCID:5047 Length:636 Species:Homo sapiens
Sequence 2:NP_998591.1 Gene:hnrnpr / 406735 ZFINID:ZDB-GENE-040426-2766 Length:214 Species:Danio rerio


Alignment Length:207 Identity:167/207 - (80%)
Similarity:185/207 - (89%) Gaps:7/207 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQT------GLVAYVD 59
            ||.:|||::|.||||||||:.:: ..:|:|:.|::|||||||||.||.||||      |||||.|
Zfish     1 MAAEVNGSSVLLKEEEEPMEVTA-PRSENYQALLDAGLPQKVAESLDNIFQTGESAEHGLVAYAD 64

Human    60 LDERAIDALREFNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKTYRQREKQGSKVQESTKGPDE 124
            |||||:|||||||||||||||||||||||||||||||||||||||||||||||:|||||:|||||
Zfish    65 LDERALDALREFNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKTYRQREKQGNKVQESSKGPDE 129

Human   125 AKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYEDELVPLFEKAG 189
            .||||||:|||||||||||||||||||||:|:||.||||||||||||||||||||||||||||||
Zfish   130 TKIKALLDRTGYTLDVTTGQRKYGGPPPDAVFSGPQPGIGTEVFVGKIPRDLYEDELVPLFEKAG 194

Human   190 PIWDLRLMMDPL 201
            .|||||..:.||
Zfish   195 SIWDLRRDVWPL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPRNP_001095868.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 14/22 (64%)
NURR_hnRNPR 27..110 CDD:410955 72/88 (82%)
hnRNP-R-Q 106..631 CDD:273732 84/96 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..459
Nuclear localization signal. /evidence=ECO:0000255 415..421
RNA-binding RGG-box 450..570
3 X 11 AA approximate repeats of D-D-Y-Y-G-Y-D-Y-H-D-Y 465..500
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 504..636
hnrnprNP_998591.1 RRM_SF 169..>200 CDD:302621 29/30 (97%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C194331527
Domainoid 1 1.000 400 1.000 Domainoid score I4616
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1093 1.000 Inparanoid score I1921
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49453
OrthoDB 1 1.010 - - D1384330at2759
OrthoFinder 1 1.000 - - FOG0000581
OrthoInspector 1 1.000 - - oto52102
orthoMCL 1 0.900 - - OOG6_104511
Panther 1 1.100 - - LDO PTHR21245
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X331
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 1 1.500 - -
1414.310

Return to query results.
Submit another query.