Sequence 1: | NP_001128689.1 | Gene: | LRRC23 / 10233 | HGNCID: | 19138 | Length: | 343 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649175.1 | Gene: | CG14185 / 40197 | FlyBaseID: | FBgn0036936 | Length: | 402 | Species: | Drosophila melanogaster |
Alignment Length: | 226 | Identity: | 54/226 - (23%) |
---|---|---|---|
Similarity: | 84/226 - (37%) | Gaps: | 64/226 - (28%) |
- Green bases have known domain annotations that are detailed below.
Human 145 QITDTEGISH-------------------PRLETLNLKGNSIHMVTGLDPEKLISLHTVELRG-- 188
Human 189 -NQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLHLRDNQIDTLSGFSREMKSLQYLNL 252
Human 253 RGNMVANLGELAKLRDLPKLRALVLLDNPCTDETSYRQEALVQMPYLERLD----------KEFY 307
Human 308 EEEERAEADV------IRQRLKEEKEQEPEP 332 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
LRRC23 | NP_001128689.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..47 | ||
LRR 1 | 92..113 | ||||
leucine-rich repeat | 93..114 | CDD:275380 | |||
LRR 2 | 114..134 | ||||
leucine-rich repeat | 115..135 | CDD:275380 | |||
LRR 3 | 135..155 | 4/28 (14%) | |||
leucine-rich repeat | 136..156 | CDD:275380 | 4/29 (14%) | ||
LRR 4 | 156..177 | 6/20 (30%) | |||
leucine-rich repeat | 157..180 | CDD:275380 | 6/22 (27%) | ||
LRR 5 | 180..200 | 4/22 (18%) | |||
leucine-rich repeat | 181..201 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 200..255 | CDD:290566 | 12/54 (22%) | ||
LRR_4 | 200..241 | CDD:289563 | 10/40 (25%) | ||
LRR 6 | 201..222 | 5/20 (25%) | |||
leucine-rich repeat | 202..223 | CDD:275380 | 6/20 (30%) | ||
LRR_4 | 223..265 | CDD:289563 | 9/41 (22%) | ||
LRR 7 | 223..244 | 3/20 (15%) | |||
leucine-rich repeat | 224..246 | CDD:275380 | 3/21 (14%) | ||
LRR 8 | 246..267 | 6/20 (30%) | |||
leucine-rich repeat | 247..271 | CDD:275380 | 7/23 (30%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 318..343 | 5/15 (33%) | |||
CG14185 | NP_649175.1 | LRR_8 | 144..201 | CDD:290566 | 16/59 (27%) |
leucine-rich repeat | 146..168 | CDD:275380 | 6/22 (27%) | ||
LRR_4 | 168..209 | CDD:289563 | 11/42 (26%) | ||
leucine-rich repeat | 169..190 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 191..212 | CDD:275380 | 6/25 (24%) | ||
leucine-rich repeat | 213..237 | CDD:275380 | 9/41 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |