Sequence 1: | NP_001128689.1 | Gene: | LRRC23 / 10233 | HGNCID: | 19138 | Length: | 343 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_608811.2 | Gene: | Cep97 / 33610 | FlyBaseID: | FBgn0031575 | Length: | 806 | Species: | Drosophila melanogaster |
Alignment Length: | 278 | Identity: | 69/278 - (24%) |
---|---|---|---|
Similarity: | 113/278 - (40%) | Gaps: | 65/278 - (23%) |
- Green bases have known domain annotations that are detailed below.
Human 36 GEEFPEEWLPTPLTEDMMKEGLSLLCKTGNGLAHAYVKLEVKERDLTDIYLLRSYIHLRYVDISE 100
Human 101 NHLTDLSPLNYLTHLLWLKADGNRLRSAQMNELPYLQIASFAYNQITDTEGISH-PRLETLNLKG 164
Human 165 NSIHMVTGLDPEKLISLHTVELRGNQLESTLGIN-LPKLKNLYLAQNMLKKVEGLEDLSNLTTLH 228
Human 229 LR--DNQIDTLSGFSREMKSLQYLNLRGNMVANLGELAKLRDLPKLRALVLLDNPCT------DE 285
Human 286 TSYRQEAL---VQMPYLE 300 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
LRRC23 | NP_001128689.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..47 | 4/10 (40%) | |
LRR 1 | 92..113 | 2/20 (10%) | |||
leucine-rich repeat | 93..114 | CDD:275380 | 2/20 (10%) | ||
LRR 2 | 114..134 | 2/19 (11%) | |||
leucine-rich repeat | 115..135 | CDD:275380 | 3/19 (16%) | ||
LRR 3 | 135..155 | 5/20 (25%) | |||
leucine-rich repeat | 136..156 | CDD:275380 | 5/20 (25%) | ||
LRR 4 | 156..177 | 8/20 (40%) | |||
leucine-rich repeat | 157..180 | CDD:275380 | 8/22 (36%) | ||
LRR 5 | 180..200 | 4/20 (20%) | |||
leucine-rich repeat | 181..201 | CDD:275380 | 5/20 (25%) | ||
LRR_8 | 200..255 | CDD:290566 | 16/56 (29%) | ||
LRR_4 | 200..241 | CDD:289563 | 12/42 (29%) | ||
LRR 6 | 201..222 | 7/20 (35%) | |||
leucine-rich repeat | 202..223 | CDD:275380 | 7/20 (35%) | ||
LRR_4 | 223..265 | CDD:289563 | 12/43 (28%) | ||
LRR 7 | 223..244 | 5/22 (23%) | |||
leucine-rich repeat | 224..246 | CDD:275380 | 5/23 (22%) | ||
LRR 8 | 246..267 | 7/20 (35%) | |||
leucine-rich repeat | 247..271 | CDD:275380 | 8/23 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 318..343 | ||||
Cep97 | NP_608811.2 | leucine-rich repeat | 11..31 | CDD:275380 | 4/21 (19%) |
leucine-rich repeat | 32..53 | CDD:275380 | 6/20 (30%) | ||
LRR_RI | <49..189 | CDD:238064 | 45/185 (24%) | ||
LRR_4 | 76..115 | CDD:289563 | 12/38 (32%) | ||
leucine-rich repeat | 76..97 | CDD:275380 | 5/20 (25%) | ||
LRR_8 | 97..152 | CDD:290566 | 19/56 (34%) | ||
LRR_4 | 97..137 | CDD:289563 | 12/41 (29%) | ||
leucine-rich repeat | 98..119 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 120..141 | CDD:275380 | 5/20 (25%) | ||
LRR_8 | 140..200 | CDD:290566 | 23/82 (28%) | ||
leucine-rich repeat | 142..165 | CDD:275380 | 12/45 (27%) | ||
leucine-rich repeat | 166..190 | CDD:275380 | 8/23 (35%) | ||
IQ | 581..599 | CDD:197470 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |