DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRRC23 and Cep97

DIOPT Version :9

Sequence 1:NP_001128689.1 Gene:LRRC23 / 10233 HGNCID:19138 Length:343 Species:Homo sapiens
Sequence 2:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster


Alignment Length:278 Identity:69/278 - (24%)
Similarity:113/278 - (40%) Gaps:65/278 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    36 GEEFPEEWLPTPLTEDMMKEGLSLLCKTGNGLAHAYVKLEVKERDLTDIYLLRSYIHLRYVDISE 100
            |:|..||    ....::.|:.|..:.|..:  ||:..:|.:.|.:|..|..:.||:.:..:.::.
  Fly     3 GDESGEE----KHVLNLSKQKLKKVPKQDD--AHSIRQLILDENELQKIDNIDSYLKIETLSLAR 61

Human   101 NHLTDLSPLNYLTHLLWLKADGNRLRSAQMNELPYLQIASFAYNQITDTEGISH-PRLETLNLKG 164
            |.|                     ||...:..|..|:..:.::|.|...||:.. ..|..|||:|
  Fly    62 NQL---------------------LRMYGVCRLHCLRELNLSFNGILSIEGLKECIHLRVLNLEG 105

Human   165 NSIHMVTGLDPEKLISLHTVELRGNQLESTLGIN-LPKLKNLYLAQNMLKKVEGLEDLSNLTTLH 228
            |:|..:..|:..  ::|..:.|..|.:.|...:: |..||.|||..|.|              .|
  Fly   106 NNIKTIEHLNTN--VNLECLNLADNSIGSISDMSYLRNLKELYLHGNRL--------------TH 154

Human   229 LR--DNQIDTLSGFSREMKSLQYLNLRGNMVANLGELAKLRDLPKLRALVLLDNPCT------DE 285
            ||  |..:.|         ||:.|.|..|.:.:|.|:..|..|..|.::.:.||||.      |.
  Fly   155 LRQCDKCLPT---------SLETLTLAKNSINDLNEICTLSHLSNLLSISIADNPCVTMINSLDG 210

Human   286 TSYRQEAL---VQMPYLE 300
            ..||...|   :.:.|::
  Fly   211 FDYRPFVLNWCMSLKYID 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRRC23NP_001128689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 4/10 (40%)
LRR 1 92..113 2/20 (10%)
leucine-rich repeat 93..114 CDD:275380 2/20 (10%)
LRR 2 114..134 2/19 (11%)
leucine-rich repeat 115..135 CDD:275380 3/19 (16%)
LRR 3 135..155 5/20 (25%)
leucine-rich repeat 136..156 CDD:275380 5/20 (25%)
LRR 4 156..177 8/20 (40%)
leucine-rich repeat 157..180 CDD:275380 8/22 (36%)
LRR 5 180..200 4/20 (20%)
leucine-rich repeat 181..201 CDD:275380 5/20 (25%)
LRR_8 200..255 CDD:290566 16/56 (29%)
LRR_4 200..241 CDD:289563 12/42 (29%)
LRR 6 201..222 7/20 (35%)
leucine-rich repeat 202..223 CDD:275380 7/20 (35%)
LRR_4 223..265 CDD:289563 12/43 (28%)
LRR 7 223..244 5/22 (23%)
leucine-rich repeat 224..246 CDD:275380 5/23 (22%)
LRR 8 246..267 7/20 (35%)
leucine-rich repeat 247..271 CDD:275380 8/23 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..343
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380 4/21 (19%)
leucine-rich repeat 32..53 CDD:275380 6/20 (30%)
LRR_RI <49..189 CDD:238064 45/185 (24%)
LRR_4 76..115 CDD:289563 12/38 (32%)
leucine-rich repeat 76..97 CDD:275380 5/20 (25%)
LRR_8 97..152 CDD:290566 19/56 (34%)
LRR_4 97..137 CDD:289563 12/41 (29%)
leucine-rich repeat 98..119 CDD:275380 8/22 (36%)
leucine-rich repeat 120..141 CDD:275380 5/20 (25%)
LRR_8 140..200 CDD:290566 23/82 (28%)
leucine-rich repeat 142..165 CDD:275380 12/45 (27%)
leucine-rich repeat 166..190 CDD:275380 8/23 (35%)
IQ 581..599 CDD:197470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.