DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLIN3 and pqn-79

DIOPT Version :10

Sequence 1:NP_005808.3 Gene:PLIN3 / 10226 HGNCID:16893 Length:434 Species:Homo sapiens
Sequence 2:NP_502875.1 Gene:pqn-79 / 190872 WormBaseID:WBGene00004160 Length:335 Species:Caenorhabditis elegans


Alignment Length:100 Identity:19/100 - (19%)
Similarity:33/100 - (33%) Gaps:36/100 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   314 KEPPKPEQVESRALTMFRDIAQQLQATC---------------TSLGSSIQGLPTNVKDQVQQAR 363
            ::|..|:             .||.|:.|               .|:..|.|.:|...:...||..
 Worm   227 QQPAAPQ-------------CQQCQSACQSPVVAPQIVTVILEPSVSQSAQCVPQCQQSCQQQCI 278

Human   364 RQVEDL--------QATFSSIHSFQDLSSSILAQS 390
            :|.:.:        |:.:.|..:.|.:....|.||
 Worm   279 QQQQPMQQCAPACTQSCYQSCSTAQPVQMPCLTQS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLIN3NP_005808.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Perilipin 18..425 CDD:460784 18/99 (18%)
pqn-79NP_502875.1 DUF1096 19..69 CDD:368941
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.