DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLIN3 and pqn-91

DIOPT Version :10

Sequence 1:NP_005808.3 Gene:PLIN3 / 10226 HGNCID:16893 Length:434 Species:Homo sapiens
Sequence 2:NP_502844.1 Gene:pqn-91 / 190672 WormBaseID:WBGene00004171 Length:419 Species:Caenorhabditis elegans


Alignment Length:78 Identity:23/78 - (29%)
Similarity:29/78 - (37%) Gaps:22/78 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    12 TQVTVEEPVQ-QPSVVDRVASMPLISSTCDMVSAAYASTKESYPHIKTVCDAAEKGVRTLTAAAV 75
            ||:....||| |||      .||....:|   .|....|.:..|..:..|          |...|
 Worm   118 TQIAAPAPVQCQPS------CMPACEQSC---VAPAPVTVQCVPQCQQKC----------TQQCV 163

Human    76 SGAQPILSKLEPQ 88
            . |||| .:.:||
 Worm   164 Q-AQPI-QQCQPQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLIN3NP_005808.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 5/10 (50%)
Perilipin 18..425 CDD:460784 21/72 (29%)
pqn-91NP_502844.1 DUF1096 19..67 CDD:368941
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.