DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLIN3 and abu-11

DIOPT Version :10

Sequence 1:NP_005808.3 Gene:PLIN3 / 10226 HGNCID:16893 Length:434 Species:Homo sapiens
Sequence 2:NP_493679.1 Gene:abu-11 / 173404 WormBaseID:WBGene00000034 Length:395 Species:Caenorhabditis elegans


Alignment Length:65 Identity:18/65 - (27%)
Similarity:28/65 - (43%) Gaps:3/65 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   307 KQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQVEDLQA 371
            :|.|..:..|......|...:...:.|| |.|::|:|...|....|..::...||..:|  |.||
 Worm    74 QQYQQQQCAPTCQSSCEQSCVAQQQPIA-QCQSSCSSTCQSACAQPVQLQQPAQQQCQQ--DCQA 135

Human   372  371
             Worm   136  135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLIN3NP_005808.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Perilipin 18..425 CDD:460784 18/65 (28%)
abu-11NP_493679.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.