DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPA33 and hbs

DIOPT Version :9

Sequence 1:NP_005805.1 Gene:GPA33 / 10223 HGNCID:4445 Length:319 Species:Homo sapiens
Sequence 2:NP_001286439.1 Gene:hbs / 44129 FlyBaseID:FBgn0029082 Length:1235 Species:Drosophila melanogaster


Alignment Length:253 Identity:65/253 - (25%)
Similarity:101/253 - (39%) Gaps:39/253 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    15 VRVTVDAISVETPQDVL-----RASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPF 74
            :|..::...:..|:||.     :|..|.||.|.|.  |:.|:.:..|.|.               
  Fly   334 LRAELNLTVLYAPKDVYLSGANQAKVGDSVQLSCV--TAPSNPQARISWS--------------- 381

Human    75 SNKNYIHGELYKNRVSISNN-AEQSDASITIDQLTMADNGTY--ECSVSLMSDLEGNTKSRVRLL 136
            .|...:....||...|.... ...|:.|:|||    :.:.|:  .|. :|.::|..|......:.
  Fly   382 INGRPLDNSTYKTTSSSDGGWVSSSNISLTID----SQSRTFIAVCH-ALNTELTQNVVGSHTVN 441

Human   137 VLVPPSKP-ECGI-EGETII-GNNIQLTCQSKEGSPTPQYSW-KRYNILNQEQPLAQPASGQPVS 197
            ||.|||.| ..|. :|:.:| |:.::|.|.|..|:|.|...| |...|:|....|........:|
  Fly   442 VLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPTLQWYKNDKIINAPSKLVDSKITSELS 506

Human   198 LKNISTDTSGYYICTSSNE--EGTQFCNITVAVRSPSMNVALYV---GIAVGVVAALI 250
            |...::|.:..|.|...|.  :...|...|:.|..|...|.:.|   .:..|:.|.||
  Fly   507 LLVNASDNNAIYKCKVQNAAIDIPLFATKTLGVHFPPETVKISVVPKNLVPGIRAKLI 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPA33NP_005805.1 V-set 26..138 CDD:311561 27/119 (23%)
IGc2 154..218 CDD:197706 19/67 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..319
hbsNP_001286439.1 Ig 44..122 CDD:299845
IG_like 45..137 CDD:214653
Ig 153..231 CDD:299845
IG_like 258..342 CDD:214653 1/7 (14%)
Ig 266..327 CDD:299845
IG_like 357..>414 CDD:214653 19/77 (25%)
Ig 360..427 CDD:299845 20/88 (23%)
Ig <468..526 CDD:299845 17/57 (30%)
I-set 547..633 CDD:254352 5/18 (28%)
Ig 556..631 CDD:299845 4/9 (44%)
I-set 644..735 CDD:254352
IGc2 668..725 CDD:197706
IG_like 751..829 CDD:214653
IGc2 753..815 CDD:197706
Ig 852..928 CDD:143165
FN3 935..1017 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.